BLASTX nr result
ID: Rehmannia23_contig00029635
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00029635 (533 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75833.1| hypothetical protein VITISV_039637 [Vitis vinifera] 56 4e-06 >emb|CAN75833.1| hypothetical protein VITISV_039637 [Vitis vinifera] Length = 1281 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 435 FVSWEKKKEALMHLSLWKPLSHCAALILDKKSR 533 F + K+EALMHLSLWKP+SHCA+LI+DKKSR Sbjct: 333 FQEIDSKREALMHLSLWKPISHCASLIMDKKSR 365