BLASTX nr result
ID: Rehmannia23_contig00028883
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00028883 (387 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOX92223.1| Uncharacterized protein TCM_001203 [Theobroma cacao] 60 2e-07 >gb|EOX92223.1| Uncharacterized protein TCM_001203 [Theobroma cacao] Length = 77 Score = 60.5 bits (145), Expect = 2e-07 Identities = 34/62 (54%), Positives = 41/62 (66%), Gaps = 3/62 (4%) Frame = -2 Query: 365 MSSTGASYAYVYVQQKRQKEKMKKILEDERAKNGGKVIVDDSYKSG---GNKKVHPGNFM 195 MSS GAS A VY+ +KRQKEKMK+ +E+ER K G + K+G G KVHPGNF Sbjct: 1 MSSIGASCAEVYLMRKRQKEKMKR-MEEERVKRGETTTGIEERKAGTIVGRSKVHPGNFT 59 Query: 194 SP 189 SP Sbjct: 60 SP 61