BLASTX nr result
ID: Rehmannia23_contig00028859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00028859 (380 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512209.1| myosin XI, putative [Ricinus communis] gi|22... 56 4e-06 gb|ABJ53198.1| myosin XI-F [Nicotiana benthamiana] 56 4e-06 >ref|XP_002512209.1| myosin XI, putative [Ricinus communis] gi|223548753|gb|EEF50243.1| myosin XI, putative [Ricinus communis] Length = 1529 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +2 Query: 2 EISQSFRDISVSNVDPPPLLRQRSDFHFLLQTTE 103 E+ +SF IS+S+VDPPPLLRQRSDFHFLLQTT+ Sbjct: 1494 ELFRSFCAISLSDVDPPPLLRQRSDFHFLLQTTD 1527 >gb|ABJ53198.1| myosin XI-F [Nicotiana benthamiana] Length = 1569 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +2 Query: 2 EISQSFRDISVSNVDPPPLLRQRSDFHFLLQTTE*EF 112 EIS+SF I++S+V+PPPLLRQRSDF FLLQ TE EF Sbjct: 1533 EISRSFHIINLSDVEPPPLLRQRSDFQFLLQATEKEF 1569