BLASTX nr result
ID: Rehmannia23_contig00028844
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00028844 (472 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS60643.1| hypothetical protein M569_14159, partial [Genlise... 61 1e-07 >gb|EPS60643.1| hypothetical protein M569_14159, partial [Genlisea aurea] Length = 238 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +1 Query: 361 QFNKSRNGDDRFYSASRARRSQDFLRRAQSDVTSRRS 471 QFN+SRNG+DRFYSA+RAR +QD LRRA+SDVTS RS Sbjct: 7 QFNRSRNGEDRFYSAARARLNQDSLRRAKSDVTSSRS 43