BLASTX nr result
ID: Rehmannia23_contig00028789
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00028789 (512 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264608.2| PREDICTED: uncharacterized protein LOC100250... 54 7e-07 ref|XP_002531080.1| nutrient reservoir, putative [Ricinus commun... 46 8e-06 >ref|XP_002264608.2| PREDICTED: uncharacterized protein LOC100250375 [Vitis vinifera] Length = 542 Score = 54.3 bits (129), Expect(2) = 7e-07 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -1 Query: 86 AMSRCFPFPPPGYEKKARPDDANLIIKK 3 AMSRCFPFPPPGYEKKAR DDA+L+ K+ Sbjct: 18 AMSRCFPFPPPGYEKKARTDDADLLKKE 45 Score = 24.3 bits (51), Expect(2) = 7e-07 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -3 Query: 219 MNARTWCMDSIIVS 178 MNA +WCMD IV+ Sbjct: 1 MNAGSWCMDRSIVA 14 >ref|XP_002531080.1| nutrient reservoir, putative [Ricinus communis] gi|223529326|gb|EEF31294.1| nutrient reservoir, putative [Ricinus communis] Length = 518 Score = 46.2 bits (108), Expect(2) = 8e-06 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = -1 Query: 92 SSAMSRCFPFPPPGYEKKARPDDANLIIKK 3 S MSRCFPFP PGYEKK R DD +L+ K+ Sbjct: 16 SLEMSRCFPFPRPGYEKKPRTDDTDLLKKE 45 Score = 28.9 bits (63), Expect(2) = 8e-06 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 219 MNARTWCMDSIIVSG 175 M ARTWCMD I+SG Sbjct: 1 MTARTWCMDKSILSG 15