BLASTX nr result
ID: Rehmannia23_contig00028312
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00028312 (544 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW04122.1| hypothetical protein PHAVU_011G069000g [Phaseolus... 65 8e-09 ref|XP_006340302.1| PREDICTED: putative pentatricopeptide repeat... 65 1e-08 ref|XP_004495883.1| PREDICTED: putative pentatricopeptide repeat... 62 7e-08 gb|EOX95372.1| Pentatricopeptide repeat superfamily protein isof... 62 9e-08 gb|EOX95371.1| Pentatricopeptide repeat superfamily protein isof... 62 9e-08 ref|XP_002279193.1| PREDICTED: putative pentatricopeptide repeat... 62 9e-08 ref|XP_004295891.1| PREDICTED: putative pentatricopeptide repeat... 62 1e-07 ref|XP_002310039.2| hypothetical protein POPTR_0007s06780g [Popu... 61 2e-07 gb|EMJ24201.1| hypothetical protein PRUPE_ppa006785mg [Prunus pe... 60 3e-07 ref|XP_003518677.1| PREDICTED: putative pentatricopeptide repeat... 60 3e-07 ref|XP_006492377.1| PREDICTED: putative pentatricopeptide repeat... 60 4e-07 ref|XP_003591356.1| Pentatricopeptide repeat-containing protein ... 59 1e-06 ref|XP_006444562.1| hypothetical protein CICLE_v10019795mg [Citr... 58 1e-06 gb|EMJ28026.1| hypothetical protein PRUPE_ppa017644mg, partial [... 58 1e-06 ref|XP_002515231.1| pentatricopeptide repeat-containing protein,... 58 1e-06 ref|XP_004251431.1| PREDICTED: putative pentatricopeptide repeat... 58 2e-06 ref|XP_003536858.1| PREDICTED: putative pentatricopeptide repeat... 57 3e-06 >gb|ESW04122.1| hypothetical protein PHAVU_011G069000g [Phaseolus vulgaris] Length = 500 Score = 65.5 bits (158), Expect = 8e-09 Identities = 33/55 (60%), Positives = 42/55 (76%) Frame = -1 Query: 544 QKPSYVSFRRIKVLMELANKHEAISNLSEKMSSFGSANQMRKSYVDELDKPISDF 380 QKPS VSFRRIKVLMELAN+HEA+ +L++KMS FG Q+ +S V + + P S F Sbjct: 443 QKPSNVSFRRIKVLMELANRHEALESLTQKMSIFGRPLQLHQSSVSQTETPDSLF 497 >ref|XP_006340302.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g02420-like [Solanum tuberosum] Length = 505 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/57 (57%), Positives = 43/57 (75%) Frame = -1 Query: 544 QKPSYVSFRRIKVLMELANKHEAISNLSEKMSSFGSANQMRKSYVDELDKPISDFIS 374 QKPS VSFRRIKVLMELANK E + LSEKM++FGS+ Q+ + E ++ SDF++ Sbjct: 449 QKPSNVSFRRIKVLMELANKQETLKLLSEKMAAFGSSTQLIQHDKAEYEQSSSDFVT 505 >ref|XP_004495883.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g02420-like [Cicer arietinum] Length = 502 Score = 62.4 bits (150), Expect = 7e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -1 Query: 544 QKPSYVSFRRIKVLMELANKHEAISNLSEKMSSFGSANQMRKS 416 QKPS VSFRRIKVLMELAN+HEAI NL++KM FG Q+R++ Sbjct: 443 QKPSNVSFRRIKVLMELANRHEAIQNLTQKMGVFGQTLQVREN 485 >gb|EOX95372.1| Pentatricopeptide repeat superfamily protein isoform 2 [Theobroma cacao] Length = 279 Score = 62.0 bits (149), Expect = 9e-08 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 541 KPSYVSFRRIKVLMELANKHEAISNLSEKMSSFGSANQM 425 KPS VSFRRIKVLMELANKHEA+ NL EKM+ FGS+ Q+ Sbjct: 217 KPSNVSFRRIKVLMELANKHEAVKNLKEKMAVFGSSIQL 255 >gb|EOX95371.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] Length = 511 Score = 62.0 bits (149), Expect = 9e-08 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 541 KPSYVSFRRIKVLMELANKHEAISNLSEKMSSFGSANQM 425 KPS VSFRRIKVLMELANKHEA+ NL EKM+ FGS+ Q+ Sbjct: 449 KPSNVSFRRIKVLMELANKHEAVKNLKEKMAVFGSSIQL 487 >ref|XP_002279193.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g02420-like [Vitis vinifera] Length = 526 Score = 62.0 bits (149), Expect = 9e-08 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -1 Query: 541 KPSYVSFRRIKVLMELANKHEAISNLSEKMSSFGSANQMRK 419 KPS VSFRRIKVLMELANKHEA+ NL+EKM+ FG + Q+++ Sbjct: 470 KPSNVSFRRIKVLMELANKHEALQNLTEKMAMFGPSTQVQE 510 >ref|XP_004295891.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g02420-like [Fragaria vesca subsp. vesca] Length = 504 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/56 (57%), Positives = 41/56 (73%) Frame = -1 Query: 541 KPSYVSFRRIKVLMELANKHEAISNLSEKMSSFGSANQMRKSYVDELDKPISDFIS 374 KPS VSFRRIKVLMELANKHEA+ NL+EKM+ FGS+ + +S P S+ ++ Sbjct: 449 KPSNVSFRRIKVLMELANKHEALKNLTEKMALFGSSIHLPESMDRSTVVPCSEALA 504 >ref|XP_002310039.2| hypothetical protein POPTR_0007s06780g [Populus trichocarpa] gi|550334290|gb|EEE90489.2| hypothetical protein POPTR_0007s06780g [Populus trichocarpa] Length = 509 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 541 KPSYVSFRRIKVLMELANKHEAISNLSEKMSSFGSA 434 KPS VSFRRIKVLMELANKH+AI NLSEKM+ FGS+ Sbjct: 455 KPSNVSFRRIKVLMELANKHDAIRNLSEKMAIFGSS 490 >gb|EMJ24201.1| hypothetical protein PRUPE_ppa006785mg [Prunus persica] Length = 395 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 541 KPSYVSFRRIKVLMELANKHEAISNLSEKMSSFGSA 434 KPS VSFRRIKVLMELANKHEA+ NL+EKM+ FGS+ Sbjct: 339 KPSNVSFRRIKVLMELANKHEALKNLTEKMAVFGSS 374 >ref|XP_003518677.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g02420-like [Glycine max] Length = 500 Score = 60.5 bits (145), Expect = 3e-07 Identities = 31/55 (56%), Positives = 41/55 (74%) Frame = -1 Query: 544 QKPSYVSFRRIKVLMELANKHEAISNLSEKMSSFGSANQMRKSYVDELDKPISDF 380 QKPS+VSFRRIKVLMELAN+HEA+ +L +KM+ FG Q+ +S V+ + S F Sbjct: 443 QKPSHVSFRRIKVLMELANRHEALQSLMQKMAMFGRPLQVDQSTVNPAETSDSLF 497 >ref|XP_006492377.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g02420-like [Citrus sinensis] Length = 506 Score = 59.7 bits (143), Expect = 4e-07 Identities = 35/58 (60%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = -1 Query: 541 KPSYVSFRRIKVLMELANKHEAISNLSEKMSSFG-SANQMRKSYVDELDKPISDFISC 371 KPS VSFRRIKVLMELANK EA+ NLS KM+ FG S R+ Y+ E+ SD SC Sbjct: 451 KPSQVSFRRIKVLMELANKQEALQNLSNKMALFGPSMIPKREEYLAEMS--ASDSFSC 506 >ref|XP_003591356.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355480404|gb|AES61607.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 518 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -1 Query: 544 QKPSYVSFRRIKVLMELANKHEAISNLSEKMSSFGSANQMRK 419 Q+PS VSF+RIKVLMELANKHEAI NL++KM+ FG Q+ + Sbjct: 437 QRPSNVSFKRIKVLMELANKHEAIQNLTQKMAIFGRPLQVHE 478 >ref|XP_006444562.1| hypothetical protein CICLE_v10019795mg [Citrus clementina] gi|557546824|gb|ESR57802.1| hypothetical protein CICLE_v10019795mg [Citrus clementina] Length = 506 Score = 58.2 bits (139), Expect = 1e-06 Identities = 34/58 (58%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Frame = -1 Query: 541 KPSYVSFRRIKVLMELANKHEAISNLSEKMSSFG-SANQMRKSYVDELDKPISDFISC 371 KPS VSFRRIK LMELANK EA+ NLS KM+ FG S R+ Y+ E+ SD SC Sbjct: 451 KPSQVSFRRIKALMELANKQEALQNLSNKMALFGPSMIPKREEYLAEMS--ASDSFSC 506 >gb|EMJ28026.1| hypothetical protein PRUPE_ppa017644mg, partial [Prunus persica] Length = 351 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -1 Query: 541 KPSYVSFRRIKVLMELANKHEAISNLSEKMSSFGSA 434 KPS VSFR IKVLMELANKHEA+ NL+EKM+ FGS+ Sbjct: 299 KPSNVSFRMIKVLMELANKHEALKNLTEKMAVFGSS 334 >ref|XP_002515231.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545711|gb|EEF47215.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 505 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 8/55 (14%) Frame = -1 Query: 541 KPSYVSFRRIKVLMELANKHEAISNLSEKMSSFGSANQM--------RKSYVDEL 401 KPS VSFRRIKVLMEL NKH+A+ NL +KM+ FGS+ Q+ SY+D L Sbjct: 449 KPSNVSFRRIKVLMELVNKHDALLNLQKKMAIFGSSIQLPEREEHLNETSYIDSL 503 >ref|XP_004251431.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g02420-like [Solanum lycopersicum] Length = 500 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 544 QKPSYVSFRRIKVLMELANKHEAISNLSEKMSSFGSANQM 425 QKPS VSFRRIKVLMELANK EA+ LSEKM++F S+ Q+ Sbjct: 449 QKPSNVSFRRIKVLMELANKQEALKLLSEKMAAFRSSTQL 488 >ref|XP_003536858.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g02420-like [Glycine max] Length = 279 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -1 Query: 544 QKPSYVSFRRIKVLMELANKHEAISNLSEKMSSFGSANQMR 422 QKPS+VSFRRIKVLMELAN+HEA+ +L++KM+ F Q+R Sbjct: 239 QKPSHVSFRRIKVLMELANRHEALQSLTQKMAIFRRPLQVR 279