BLASTX nr result
ID: Rehmannia23_contig00028272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00028272 (517 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73264.1| hypothetical protein M569_01491, partial [Genlise... 74 3e-11 >gb|EPS73264.1| hypothetical protein M569_01491, partial [Genlisea aurea] Length = 465 Score = 73.6 bits (179), Expect = 3e-11 Identities = 37/57 (64%), Positives = 47/57 (82%), Gaps = 1/57 (1%) Frame = +2 Query: 260 QLASLRFLQFPVSSLLEYSGILRVQ-PDYPYSEAHPLIPENMNNGVNAQNPSRSESI 427 QL +LRFLQ PVSSLLEYSGILR++ PDYPYSEA PL+PE+ N+ +A++ SE+I Sbjct: 35 QLQALRFLQSPVSSLLEYSGILRIRPPDYPYSEAQPLVPESNNSSAHARHRRISETI 91