BLASTX nr result
ID: Rehmannia23_contig00028247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00028247 (857 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006354445.1| PREDICTED: uncharacterized protein LOC102603... 61 6e-07 ref|XP_004247761.1| PREDICTED: uncharacterized protein LOC101261... 61 6e-07 >ref|XP_006354445.1| PREDICTED: uncharacterized protein LOC102603875 [Solanum tuberosum] Length = 97 Score = 60.8 bits (146), Expect = 6e-07 Identities = 27/45 (60%), Positives = 37/45 (82%) Frame = +3 Query: 492 DDESQSLLHSNKDVLSKKSEMPKRKVQWSDSSGDKLAQIMEFQPS 626 DDES++LL S K LSKK PKRKVQW+D++G+KL +++EF+PS Sbjct: 35 DDESKALLPSRKGGLSKKIAKPKRKVQWNDTNGNKLTEVLEFEPS 79 >ref|XP_004247761.1| PREDICTED: uncharacterized protein LOC101261364 [Solanum lycopersicum] Length = 97 Score = 60.8 bits (146), Expect = 6e-07 Identities = 27/45 (60%), Positives = 37/45 (82%) Frame = +3 Query: 492 DDESQSLLHSNKDVLSKKSEMPKRKVQWSDSSGDKLAQIMEFQPS 626 DDES++LL S K LSKK PKRKVQW+D++G+KL +++EF+PS Sbjct: 35 DDESKALLPSRKGGLSKKIAKPKRKVQWNDTNGNKLTEVLEFEPS 79