BLASTX nr result
ID: Rehmannia23_contig00027975
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00027975 (324 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74123.1| hypothetical protein M569_00634 [Genlisea aurea] 56 6e-06 >gb|EPS74123.1| hypothetical protein M569_00634 [Genlisea aurea] Length = 257 Score = 55.8 bits (133), Expect = 6e-06 Identities = 40/90 (44%), Positives = 51/90 (56%), Gaps = 4/90 (4%) Frame = +3 Query: 3 SFSLCLPSK-IPLMLRHRFDFGF-SGNPLYGRHRSPSLFSLSA-SVAEKNP-NLEVSWNS 170 SFSL PSK IP +LR R F F S L R+ S+ SLSA SVA K+ ++ +W S Sbjct: 3 SFSLRSPSKMIPSVLRSRLYFNFFSSGCLRVNPRNCSIVSLSAASVAGKSSAGVDFAWVS 62 Query: 171 WDKVAVDDYNGWAITESGPEPVKEKGLRTF 260 WD ++ D+YNGW E P+ G R F Sbjct: 63 WDGISPDEYNGWDFFEESPD---RNGFRAF 89