BLASTX nr result
ID: Rehmannia23_contig00027737
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00027737 (348 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum]... 77 2e-15 ref|XP_002335728.1| predicted protein [Populus trichocarpa] 69 8e-10 gb|AAA84681.1| unknown protein (chloroplast) [Nicotiana tabacum]... 49 9e-07 >gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum] gi|224352|prf||1102209F ORF 6 Length = 79 Score = 77.4 bits (189), Expect(2) = 2e-15 Identities = 43/71 (60%), Positives = 48/71 (67%), Gaps = 8/71 (11%) Frame = +1 Query: 22 MKVDYLSVYFQTSIIPSRTKHESFDSFGSHAQLLRVNSHSFFL*M**AY--------PLF 177 MKVDY S+ FQ SIIPSRTKHESFDSFGSHAQLL+VNSH FF Y LF Sbjct: 1 MKVDYFSIPFQNSIIPSRTKHESFDSFGSHAQLLKVNSHIFF------YECNEPIFSSLF 54 Query: 178 FFQSPKKTNLM 210 FQ +TN++ Sbjct: 55 IFQKDIETNVI 65 Score = 30.8 bits (68), Expect(2) = 2e-15 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +3 Query: 201 ESNAKQKYLEDSSDKIKNM 257 E+N KY EDSSDKIKNM Sbjct: 61 ETNVIPKYSEDSSDKIKNM 79 >ref|XP_002335728.1| predicted protein [Populus trichocarpa] Length = 79 Score = 68.6 bits (166), Expect = 8e-10 Identities = 33/45 (73%), Positives = 40/45 (88%), Gaps = 3/45 (6%) Frame = +1 Query: 22 MKVDYLSVYFQTSIIPSRTKHESFDSFGSHAQLLRV---NSHSFF 147 MKVDYLS++ +TS+IPSRTKHESFDSFGSHAQL+++ NSH FF Sbjct: 1 MKVDYLSIHCKTSMIPSRTKHESFDSFGSHAQLVQLLMGNSHLFF 45 >gb|AAA84681.1| unknown protein (chloroplast) [Nicotiana tabacum] gi|224350|prf||1102209D ORF 4 Length = 64 Score = 48.5 bits (114), Expect(2) = 9e-07 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -3 Query: 292 EEKKRNNFADNYIFLILSEESSKYFCFALDS 200 ++KKRNNFADNYIF ILSEESS+YF L S Sbjct: 17 KKKKRNNFADNYIFFILSEESSEYFGITLVS 47 Score = 30.0 bits (66), Expect(2) = 9e-07 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 195 FWTLKKEERIGSLHS 151 FW + KEE+IGSLHS Sbjct: 50 FWNMNKEEKIGSLHS 64