BLASTX nr result
ID: Rehmannia23_contig00027220
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00027220 (482 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004241813.1| PREDICTED: pentatricopeptide repeat-containi... 94 2e-17 ref|XP_006353639.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-15 ref|XP_002282419.1| PREDICTED: pentatricopeptide repeat-containi... 86 4e-15 ref|XP_004292965.1| PREDICTED: pentatricopeptide repeat-containi... 82 6e-14 ref|XP_006476197.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 81 2e-13 gb|EMJ23233.1| hypothetical protein PRUPE_ppa003040mg [Prunus pe... 80 2e-13 gb|ESW33251.1| hypothetical protein PHAVU_001G055200g [Phaseolus... 77 2e-12 ref|XP_003549241.1| PREDICTED: pentatricopeptide repeat-containi... 77 3e-12 ref|XP_006450554.1| hypothetical protein CICLE_v10008018mg [Citr... 76 4e-12 ref|XP_004136469.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 ref|XP_002308636.1| hypothetical protein POPTR_0006s26360g [Popu... 74 2e-11 gb|EXC20787.1| hypothetical protein L484_007369 [Morus notabilis] 73 4e-11 gb|EOY31375.1| Pentatricopeptide repeat (PPR) superfamily protei... 70 3e-10 gb|EOY31373.1| Pentatricopeptide repeat superfamily protein isof... 70 3e-10 gb|EOY31372.1| Pentatricopeptide repeat superfamily protein isof... 70 3e-10 ref|XP_002516618.1| pentatricopeptide repeat-containing protein,... 70 4e-10 ref|XP_006286475.1| hypothetical protein CARUB_v10000508mg [Caps... 67 3e-09 ref|XP_002871469.1| pentatricopeptide repeat-containing protein ... 66 5e-09 ref|XP_004498635.1| PREDICTED: pentatricopeptide repeat-containi... 65 7e-09 gb|EPS71242.1| hypothetical protein M569_03518 [Genlisea aurea] 65 1e-08 >ref|XP_004241813.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Solanum lycopersicum] Length = 602 Score = 93.6 bits (231), Expect = 2e-17 Identities = 41/83 (49%), Positives = 62/83 (74%) Frame = +2 Query: 233 SDFTRISKLLSDPALQPGPDLEEAINAAQINPSPNLLLEIFNRFDSTPKPLFTLFNWTQK 412 +DFT +S++L DP + PGP LE A++ A I + + L++FN FDS+PKPLFTL+ W +K Sbjct: 81 TDFTTLSEILRDPTIPPGPALENALDRAGIEVNECMFLQLFNHFDSSPKPLFTLYLWAEK 140 Query: 413 RSDYQFSIDVFNAMVNSLAKAQE 481 + ++FS+ VFNA+VN+L K +E Sbjct: 141 KEWFKFSLPVFNAVVNALGKERE 163 >ref|XP_006353639.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Solanum tuberosum] Length = 604 Score = 87.4 bits (215), Expect = 2e-15 Identities = 38/83 (45%), Positives = 60/83 (72%) Frame = +2 Query: 233 SDFTRISKLLSDPALQPGPDLEEAINAAQINPSPNLLLEIFNRFDSTPKPLFTLFNWTQK 412 +DFT + ++L DP + GP LE A++ A + + + L++FN FDS+PKPLFTL+ W +K Sbjct: 81 TDFTTLCEILRDPIIPAGPVLENALDRAGVEVNECMFLQLFNHFDSSPKPLFTLYLWAEK 140 Query: 413 RSDYQFSIDVFNAMVNSLAKAQE 481 + ++FS+ VFNA+VN+L K +E Sbjct: 141 KEWFKFSLPVFNAVVNALGKERE 163 >ref|XP_002282419.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Vitis vinifera] gi|296081989|emb|CBI20994.3| unnamed protein product [Vitis vinifera] Length = 597 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/82 (48%), Positives = 57/82 (69%) Frame = +2 Query: 233 SDFTRISKLLSDPALQPGPDLEEAINAAQINPSPNLLLEIFNRFDSTPKPLFTLFNWTQK 412 SDF+ I LL+DPAL G LE+A+N I P LL IF+ FD++PKPLFTLF W K Sbjct: 70 SDFSTICALLTDPALSSGAPLEDALNRTGIKPCSGLLQAIFSHFDASPKPLFTLFRWAMK 129 Query: 413 RSDYQFSIDVFNAMVNSLAKAQ 478 + ++ S+ +FN+M++ LAK++ Sbjct: 130 QPGFESSMTLFNSMIDVLAKSR 151 >ref|XP_004292965.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 582 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/83 (43%), Positives = 61/83 (73%) Frame = +2 Query: 233 SDFTRISKLLSDPALQPGPDLEEAINAAQINPSPNLLLEIFNRFDSTPKPLFTLFNWTQK 412 +DF+ I+KLL+DP++ PG L A++ I+PSP+L+ +F+ FDS+PK L TLF W ++ Sbjct: 55 NDFSTITKLLTDPSIFPGASLRSALDRVGIDPSPSLVQAVFDHFDSSPKLLHTLFVWAEE 114 Query: 413 RSDYQFSIDVFNAMVNSLAKAQE 481 + ++ S+ +F +++N LAKA+E Sbjct: 115 QPGFRCSVKLFTSVINVLAKARE 137 >ref|XP_006476197.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Citrus sinensis] Length = 551 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/83 (44%), Positives = 53/83 (63%) Frame = +2 Query: 233 SDFTRISKLLSDPALQPGPDLEEAINAAQINPSPNLLLEIFNRFDSTPKPLFTLFNWTQK 412 +DF+ IS LL +PA+ GP LE +N + P P LLL +F FD +PK L TLF W + Sbjct: 49 TDFSVISGLLRNPAISSGPSLESELNQTGVEPEPALLLAVFEHFDHSPKLLHTLFRWAES 108 Query: 413 RSDYQFSIDVFNAMVNSLAKAQE 481 + +++ S +FN M+ LAKA+E Sbjct: 109 KPEFKCSAALFNCMIKVLAKAKE 131 >gb|EMJ23233.1| hypothetical protein PRUPE_ppa003040mg [Prunus persica] Length = 609 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/83 (43%), Positives = 56/83 (67%) Frame = +2 Query: 233 SDFTRISKLLSDPALQPGPDLEEAINAAQINPSPNLLLEIFNRFDSTPKPLFTLFNWTQK 412 +DF+ I+ +L+DP++ PG L+ A++ I P P LL +F+ FDS+PK L TLF W +K Sbjct: 82 NDFSTIANVLADPSISPGSSLQSALDRTGIEPGPCLLQAVFDHFDSSPKLLHTLFLWAEK 141 Query: 413 RSDYQFSIDVFNAMVNSLAKAQE 481 R ++ S +F M+N LAK++E Sbjct: 142 RPGFRSSATLFGCMINVLAKSRE 164 >gb|ESW33251.1| hypothetical protein PHAVU_001G055200g [Phaseolus vulgaris] Length = 606 Score = 77.4 bits (189), Expect = 2e-12 Identities = 38/84 (45%), Positives = 57/84 (67%) Frame = +2 Query: 230 LSDFTRISKLLSDPALQPGPDLEEAINAAQINPSPNLLLEIFNRFDSTPKPLFTLFNWTQ 409 L+ F+ IS L +DP++ PGP L ++ + I P P LLL +F+RF S+PK L +LF W Q Sbjct: 79 LNAFSLISNLFTDPSVSPGPVLHAKLDRSAIEPDPALLLALFDRFGSSPKLLHSLFLWAQ 138 Query: 410 KRSDYQFSIDVFNAMVNSLAKAQE 481 R ++ +F+A+VN+LAKA+E Sbjct: 139 TRPGFRPGPKLFDAVVNALAKAKE 162 >ref|XP_003549241.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like isoform X1 [Glycine max] Length = 622 Score = 76.6 bits (187), Expect = 3e-12 Identities = 38/78 (48%), Positives = 53/78 (67%) Frame = +2 Query: 248 ISKLLSDPALQPGPDLEEAINAAQINPSPNLLLEIFNRFDSTPKPLFTLFNWTQKRSDYQ 427 IS L +DP+L PGP L ++ A I P P LLL +F+RF S+PK L +LF W Q R ++ Sbjct: 96 ISNLFADPSLSPGPALHAELDRAGIEPDPALLLAVFDRFGSSPKLLHSLFLWAQTRPAFR 155 Query: 428 FSIDVFNAMVNSLAKAQE 481 +F+A+VN+LAKA+E Sbjct: 156 PGPKLFDAVVNALAKARE 173 >ref|XP_006450554.1| hypothetical protein CICLE_v10008018mg [Citrus clementina] gi|557553780|gb|ESR63794.1| hypothetical protein CICLE_v10008018mg [Citrus clementina] Length = 517 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/83 (42%), Positives = 52/83 (62%) Frame = +2 Query: 233 SDFTRISKLLSDPALQPGPDLEEAINAAQINPSPNLLLEIFNRFDSTPKPLFTLFNWTQK 412 +DF+ IS LL + A+ GP LE +N + P P LLL +F FD +PK L TLF W + Sbjct: 49 TDFSVISGLLRNTAISSGPSLESELNQTGVEPEPALLLAVFEHFDHSPKLLHTLFRWAES 108 Query: 413 RSDYQFSIDVFNAMVNSLAKAQE 481 + +++ S +FN ++ LAKA+E Sbjct: 109 KPEFKCSAALFNCVIKVLAKAKE 131 >ref|XP_004136469.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Cucumis sativus] gi|449503560|ref|XP_004162063.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Cucumis sativus] Length = 615 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/83 (43%), Positives = 58/83 (69%) Frame = +2 Query: 233 SDFTRISKLLSDPALQPGPDLEEAINAAQINPSPNLLLEIFNRFDSTPKPLFTLFNWTQK 412 +D + IS +LSD +++PG LE+A++ I PS +LL +F+ FDS+PK L +LF W K Sbjct: 87 NDLSTISSILSDRSVRPGAALEDALDRTGIVPSSSLLEAVFDHFDSSPKFLHSLFLWAAK 146 Query: 413 RSDYQFSIDVFNAMVNSLAKAQE 481 +S ++ S +FN ++N LAK++E Sbjct: 147 KSGFRPSAALFNRLINVLAKSRE 169 >ref|XP_002308636.1| hypothetical protein POPTR_0006s26360g [Populus trichocarpa] gi|222854612|gb|EEE92159.1| hypothetical protein POPTR_0006s26360g [Populus trichocarpa] Length = 607 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/83 (40%), Positives = 52/83 (62%) Frame = +2 Query: 233 SDFTRISKLLSDPALQPGPDLEEAINAAQINPSPNLLLEIFNRFDSTPKPLFTLFNWTQK 412 +DF + +L DP +Q GP L A++ I P L+ +F+ FDS+PK L ++F W +K Sbjct: 80 NDFFTLCNILKDPKIQLGPSLRTALDRTGIEPELGLIQSVFDHFDSSPKLLHSVFLWAEK 139 Query: 413 RSDYQFSIDVFNAMVNSLAKAQE 481 + +Q S +FN+MVN L KA+E Sbjct: 140 KPGFQSSAALFNSMVNFLGKARE 162 >gb|EXC20787.1| hypothetical protein L484_007369 [Morus notabilis] Length = 612 Score = 72.8 bits (177), Expect = 4e-11 Identities = 33/83 (39%), Positives = 57/83 (68%) Frame = +2 Query: 233 SDFTRISKLLSDPALQPGPDLEEAINAAQINPSPNLLLEIFNRFDSTPKPLFTLFNWTQK 412 ++F IS++L++P + G L A++ I PSP+LL +F+ FDS+PK L++LF W +K Sbjct: 88 NEFAAISEVLTNPNISGGFSLHTALDRTGIEPSPSLLQAVFDHFDSSPKLLYSLFLWAEK 147 Query: 413 RSDYQFSIDVFNAMVNSLAKAQE 481 + Y+ S +F +++N LAK++E Sbjct: 148 QPGYRSSASLFASVINVLAKSRE 170 >gb|EOY31375.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 4, partial [Theobroma cacao] gi|508784121|gb|EOY31377.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 4, partial [Theobroma cacao] Length = 560 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/82 (42%), Positives = 52/82 (63%) Frame = +2 Query: 233 SDFTRISKLLSDPALQPGPDLEEAINAAQINPSPNLLLEIFNRFDSTPKPLFTLFNWTQK 412 S+F+ IS LL + + G LE A++ +I+P P LL IF FDS+PK L LF W +K Sbjct: 28 SNFSIISNLLKNSTITSGSSLESALDQTEIDPDPGLLQAIFECFDSSPKLLHHLFLWAEK 87 Query: 413 RSDYQFSIDVFNAMVNSLAKAQ 478 + ++ S +F++MVN L KA+ Sbjct: 88 KPGFKSSATLFDSMVNVLGKAR 109 >gb|EOY31373.1| Pentatricopeptide repeat superfamily protein isoform 2, partial [Theobroma cacao] Length = 584 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/82 (42%), Positives = 52/82 (63%) Frame = +2 Query: 233 SDFTRISKLLSDPALQPGPDLEEAINAAQINPSPNLLLEIFNRFDSTPKPLFTLFNWTQK 412 S+F+ IS LL + + G LE A++ +I+P P LL IF FDS+PK L LF W +K Sbjct: 52 SNFSIISNLLKNSTITSGSSLESALDQTEIDPDPGLLQAIFECFDSSPKLLHHLFLWAEK 111 Query: 413 RSDYQFSIDVFNAMVNSLAKAQ 478 + ++ S +F++MVN L KA+ Sbjct: 112 KPGFKSSATLFDSMVNVLGKAR 133 >gb|EOY31372.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508784118|gb|EOY31374.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508784120|gb|EOY31376.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] Length = 595 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/82 (42%), Positives = 52/82 (63%) Frame = +2 Query: 233 SDFTRISKLLSDPALQPGPDLEEAINAAQINPSPNLLLEIFNRFDSTPKPLFTLFNWTQK 412 S+F+ IS LL + + G LE A++ +I+P P LL IF FDS+PK L LF W +K Sbjct: 63 SNFSIISNLLKNSTITSGSSLESALDQTEIDPDPGLLQAIFECFDSSPKLLHHLFLWAEK 122 Query: 413 RSDYQFSIDVFNAMVNSLAKAQ 478 + ++ S +F++MVN L KA+ Sbjct: 123 KPGFKSSATLFDSMVNVLGKAR 144 >ref|XP_002516618.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223544438|gb|EEF45959.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 577 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/83 (40%), Positives = 55/83 (66%) Frame = +2 Query: 233 SDFTRISKLLSDPALQPGPDLEEAINAAQINPSPNLLLEIFNRFDSTPKPLFTLFNWTQK 412 SDF+ + LLSDP L+P LE A++ I P +LL +F+ F+S+PK L +LF W K Sbjct: 59 SDFSTLCNLLSDPNLKP---LETALDQTGIKPETSLLNAVFDHFNSSPKLLHSLFVWADK 115 Query: 413 RSDYQFSIDVFNAMVNSLAKAQE 481 + +++ S +FN+++N+L K +E Sbjct: 116 QPEFESSTTLFNSVINALGKMKE 138 >ref|XP_006286475.1| hypothetical protein CARUB_v10000508mg [Capsella rubella] gi|482555181|gb|EOA19373.1| hypothetical protein CARUB_v10000508mg [Capsella rubella] Length = 605 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/83 (37%), Positives = 51/83 (61%) Frame = +2 Query: 233 SDFTRISKLLSDPALQPGPDLEEAINAAQINPSPNLLLEIFNRFDSTPKPLFTLFNWTQK 412 SD + IS LL + + PG LE A+N I PS L+ +F+RF S+P L +++ W + Sbjct: 71 SDLSTISNLLENTDVAPGSSLEPALNETGIEPSVELVQALFDRFSSSPMLLHSVYKWAET 130 Query: 413 RSDYQFSIDVFNAMVNSLAKAQE 481 R + S +F++++N+L KA+E Sbjct: 131 RPGFTLSPSLFDSVINALCKARE 153 >ref|XP_002871469.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297317306|gb|EFH47728.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 602 Score = 65.9 bits (159), Expect = 5e-09 Identities = 39/133 (29%), Positives = 67/133 (50%), Gaps = 4/133 (3%) Frame = +2 Query: 95 PLATTIAHRLSLLSTQSAFSIPIPPFLKLXXXXXXXXXXXXXISAL----SDFTRISKLL 262 P + RL S +S+ IP+ P ++ I+ L +D + IS LL Sbjct: 18 PHLNFLLRRLLSSSRRSSPLIPVEPLIQRLQSPAAHDSTPHQITVLDFSKTDLSTISNLL 77 Query: 263 SDPALQPGPDLEEAINAAQINPSPNLLLEIFNRFDSTPKPLFTLFNWTQKRSDYQFSIDV 442 + + PG LE A++ I PS L+ +F+R S+P L ++F W + + + S + Sbjct: 78 ENTNVVPGSSLESALDETGIEPSLQLVQALFDRLSSSPMLLHSVFKWAEMKPGFTLSPSL 137 Query: 443 FNAMVNSLAKAQE 481 F++++NSL KA+E Sbjct: 138 FDSVINSLCKARE 150 >ref|XP_004498635.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Cicer arietinum] Length = 596 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/83 (38%), Positives = 51/83 (61%) Frame = +2 Query: 233 SDFTRISKLLSDPALQPGPDLEEAINAAQINPSPNLLLEIFNRFDSTPKPLFTLFNWTQK 412 S+F+ IS L ++P++ PG L +N I P LL +F+ F S+PK L +LF W K Sbjct: 69 SNFSLISTLFTNPSISPGSQLHAQLNRTGIKPDSPLLRAVFDHFASSPKLLHSLFLWADK 128 Query: 413 RSDYQFSIDVFNAMVNSLAKAQE 481 + ++ +F++MVN+LAK +E Sbjct: 129 QPGFKPDPTLFDSMVNALAKIKE 151 >gb|EPS71242.1| hypothetical protein M569_03518 [Genlisea aurea] Length = 496 Score = 64.7 bits (156), Expect = 1e-08 Identities = 35/84 (41%), Positives = 53/84 (63%) Frame = +2 Query: 230 LSDFTRISKLLSDPALQPGPDLEEAINAAQINPSPNLLLEIFNRFDSTPKPLFTLFNWTQ 409 ++ F+ IS+LLS DLEEA+ +A+ + N L+ RF S+ + L L+NW Q Sbjct: 1 MNAFSLISELLSKQGFVKDRDLEEALASAKFDSRRNYLI----RFGSSAEQLLPLYNWLQ 56 Query: 410 KRSDYQFSIDVFNAMVNSLAKAQE 481 +R DY+FS+ V N MV+SLAK ++ Sbjct: 57 ERPDYEFSVAVLNGMVDSLAKDRQ 80