BLASTX nr result
ID: Rehmannia23_contig00026901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00026901 (598 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527004.1| conserved hypothetical protein [Ricinus comm... 86 1e-14 >ref|XP_002527004.1| conserved hypothetical protein [Ricinus communis] gi|223533639|gb|EEF35376.1| conserved hypothetical protein [Ricinus communis] Length = 99 Score = 85.5 bits (210), Expect = 1e-14 Identities = 45/100 (45%), Positives = 64/100 (64%) Frame = +3 Query: 57 TERSSASHNQDANIIQNEVQNEVFCELLGEDQFGRVKGYGLRVTPTQINSQSFLSGERRS 236 T +S DAN+I++EV F ELL +DQ+ RVKGYG+ VTP+Q+ F + R Sbjct: 4 TTNTSTFEEHDANVIEDEV----FIELLRQDQYKRVKGYGVGVTPSQLFGSEFRPIKIRQ 59 Query: 237 NEMEVMQKELADMQANYEAKILNLTADYEGKIAQLKEDHD 356 EM+ MQ EL +M A+YE KI NL +YE K+A +K +++ Sbjct: 60 TEMDNMQNELFEMHAHYETKIANLKDEYEWKMANMKANYE 99