BLASTX nr result
ID: Rehmannia23_contig00026539
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00026539 (351 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004251101.1| PREDICTED: transcription factor LHW-like [So... 55 9e-06 >ref|XP_004251101.1| PREDICTED: transcription factor LHW-like [Solanum lycopersicum] Length = 930 Score = 55.1 bits (131), Expect = 9e-06 Identities = 35/76 (46%), Positives = 44/76 (57%), Gaps = 3/76 (3%) Frame = -3 Query: 220 VNNINYDDPCNQPCQSGDDLFDVLGADFKNKLFGSSR---LRNESATNTRNRENINSPSE 50 + N Y+D C Q SGDDLFDVLGADFKNKLF SR N +NT +R NS S Sbjct: 507 LENNKYEDSCVQR-HSGDDLFDVLGADFKNKLFNGSRNSYQSNGPDSNTWDRVKSNSTSV 565 Query: 49 KSLISSEMYSSSQVNS 2 S +S + + + +S Sbjct: 566 LSQQASSIVNQGKSDS 581