BLASTX nr result
ID: Rehmannia23_contig00025611
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00025611 (381 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67479.1| hypothetical protein VITISV_035454 [Vitis vinifera] 60 4e-07 >emb|CAN67479.1| hypothetical protein VITISV_035454 [Vitis vinifera] Length = 528 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/64 (46%), Positives = 38/64 (59%) Frame = -2 Query: 218 QAFGFPVGPSFCFAVPHNLHRRYSHLDCRIVVELHMPMLSVCDXXXXXXXXAHQSPHSCH 39 +A G + PS F + +LHRR HLD R+VV++HMP+L V D A Q PHSC Sbjct: 438 EALGVSIRPSLRFPLSPHLHRRRRHLDRRVVVDVHMPLLLVRDGTSRACAGADQGPHSCD 497 Query: 38 GVVY 27 GV Y Sbjct: 498 GVGY 501