BLASTX nr result
ID: Rehmannia23_contig00025529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00025529 (313 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006346308.1| PREDICTED: vacuolar-sorting receptor 3-like ... 71 1e-10 ref|XP_004230700.1| PREDICTED: vacuolar-sorting receptor 3-like ... 69 8e-10 ref|XP_004230699.1| PREDICTED: vacuolar-sorting receptor 3-like ... 69 8e-10 gb|EXC31466.1| Vacuolar-sorting receptor 3 [Morus notabilis] 66 4e-09 ref|XP_002264769.1| PREDICTED: vacuolar-sorting receptor 3-like ... 66 5e-09 emb|CBI22461.3| unnamed protein product [Vitis vinifera] 66 5e-09 ref|XP_006300216.1| hypothetical protein CARUB_v10016452mg [Caps... 64 3e-08 ref|XP_006486921.1| PREDICTED: vacuolar-sorting receptor 3-like ... 63 4e-08 ref|XP_006422827.1| hypothetical protein CICLE_v10028015mg [Citr... 63 4e-08 gb|EOX98464.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma... 63 5e-08 ref|XP_002968618.1| hypothetical protein SELMODRAFT_440462 [Sela... 62 6e-08 ref|XP_002975863.1| hypothetical protein SELMODRAFT_175218 [Sela... 62 6e-08 ref|XP_002885935.1| VSR-2 [Arabidopsis lyrata subsp. lyrata] gi|... 62 6e-08 ref|XP_004289804.1| PREDICTED: vacuolar-sorting receptor 3-like ... 62 8e-08 gb|EMJ00954.1| hypothetical protein PRUPE_ppa002822mg [Prunus pe... 62 8e-08 gb|AAF22842.1|AF209910_1 vacuolar sorting receptor protein [Prun... 62 8e-08 ref|XP_003592523.1| Vacuolar-sorting receptor [Medicago truncatu... 62 8e-08 ref|XP_002527509.1| zinc finger protein, putative [Ricinus commu... 62 8e-08 gb|AEZ00905.1| putative BP-80 vacuolar sorting receptor protein,... 62 1e-07 gb|ESW15110.1| hypothetical protein PHAVU_007G045100g [Phaseolus... 61 1e-07 >ref|XP_006346308.1| PREDICTED: vacuolar-sorting receptor 3-like [Solanum tuberosum] Length = 630 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +2 Query: 2 RLRSYMDSEIRAIMAQYMPLDSQNEVQNHLNEDHA 106 RLRSYMDSEIRAIMAQYMPLDSQ+EVQNH+NEDHA Sbjct: 596 RLRSYMDSEIRAIMAQYMPLDSQSEVQNHVNEDHA 630 >ref|XP_004230700.1| PREDICTED: vacuolar-sorting receptor 3-like isoform 2 [Solanum lycopersicum] Length = 630 Score = 68.6 bits (166), Expect = 8e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +2 Query: 2 RLRSYMDSEIRAIMAQYMPLDSQNEVQNHLNEDHA 106 RLRSYMDSEIRAIMAQYMPLDSQNEVQ+H+NE HA Sbjct: 596 RLRSYMDSEIRAIMAQYMPLDSQNEVQSHVNEGHA 630 >ref|XP_004230699.1| PREDICTED: vacuolar-sorting receptor 3-like isoform 1 [Solanum lycopersicum] Length = 664 Score = 68.6 bits (166), Expect = 8e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +2 Query: 2 RLRSYMDSEIRAIMAQYMPLDSQNEVQNHLNEDHA 106 RLRSYMDSEIRAIMAQYMPLDSQNEVQ+H+NE HA Sbjct: 630 RLRSYMDSEIRAIMAQYMPLDSQNEVQSHVNEGHA 664 >gb|EXC31466.1| Vacuolar-sorting receptor 3 [Morus notabilis] Length = 631 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +2 Query: 2 RLRSYMDSEIRAIMAQYMPLDSQNEVQNHLNEDHA 106 RLRSYMDSEIRAIMAQYMPLDSQ EV NH+NE+HA Sbjct: 597 RLRSYMDSEIRAIMAQYMPLDSQAEVPNHVNEEHA 631 >ref|XP_002264769.1| PREDICTED: vacuolar-sorting receptor 3-like [Vitis vinifera] Length = 636 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 2 RLRSYMDSEIRAIMAQYMPLDSQNEVQNHLNEDHA 106 R+RSYMDSEIRAIMAQYMPLDSQ EV NH++EDHA Sbjct: 602 RIRSYMDSEIRAIMAQYMPLDSQTEVPNHVSEDHA 636 >emb|CBI22461.3| unnamed protein product [Vitis vinifera] Length = 631 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 2 RLRSYMDSEIRAIMAQYMPLDSQNEVQNHLNEDHA 106 R+RSYMDSEIRAIMAQYMPLDSQ EV NH++EDHA Sbjct: 597 RIRSYMDSEIRAIMAQYMPLDSQTEVPNHVSEDHA 631 >ref|XP_006300216.1| hypothetical protein CARUB_v10016452mg [Capsella rubella] gi|482568925|gb|EOA33114.1| hypothetical protein CARUB_v10016452mg [Capsella rubella] Length = 629 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +2 Query: 2 RLRSYMDSEIRAIMAQYMPLDSQNEVQNHLNEDHA 106 RLR YMDSEIRAIMAQYMPLDSQ EV NH+N++HA Sbjct: 595 RLRQYMDSEIRAIMAQYMPLDSQPEVPNHVNDEHA 629 >ref|XP_006486921.1| PREDICTED: vacuolar-sorting receptor 3-like [Citrus sinensis] Length = 631 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +2 Query: 2 RLRSYMDSEIRAIMAQYMPLDSQNEVQNHLNEDHA 106 RLRSYMDSEIRAIMAQYMPLDSQ+EV NH+N++ A Sbjct: 597 RLRSYMDSEIRAIMAQYMPLDSQSEVPNHVNDERA 631 >ref|XP_006422827.1| hypothetical protein CICLE_v10028015mg [Citrus clementina] gi|557524761|gb|ESR36067.1| hypothetical protein CICLE_v10028015mg [Citrus clementina] Length = 631 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +2 Query: 2 RLRSYMDSEIRAIMAQYMPLDSQNEVQNHLNEDHA 106 RLRSYMDSEIRAIMAQYMPLDSQ+EV NH+N++ A Sbjct: 597 RLRSYMDSEIRAIMAQYMPLDSQSEVPNHVNDERA 631 >gb|EOX98464.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma cacao] Length = 626 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +2 Query: 2 RLRSYMDSEIRAIMAQYMPLDSQNEVQNHLNEDHA 106 RLRSYMDSEIRAIMAQYMPLDSQ EV NH++ED A Sbjct: 592 RLRSYMDSEIRAIMAQYMPLDSQAEVPNHVSEDRA 626 >ref|XP_002968618.1| hypothetical protein SELMODRAFT_440462 [Selaginella moellendorffii] gi|300164262|gb|EFJ30872.1| hypothetical protein SELMODRAFT_440462 [Selaginella moellendorffii] Length = 624 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 2 RLRSYMDSEIRAIMAQYMPLDSQNEVQNHLNED 100 RLRSYMDSEIRAIMAQYMPLDSQN+V +HL ED Sbjct: 591 RLRSYMDSEIRAIMAQYMPLDSQNDVHHHLQED 623 >ref|XP_002975863.1| hypothetical protein SELMODRAFT_175218 [Selaginella moellendorffii] gi|300156139|gb|EFJ22768.1| hypothetical protein SELMODRAFT_175218 [Selaginella moellendorffii] Length = 624 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 2 RLRSYMDSEIRAIMAQYMPLDSQNEVQNHLNED 100 RLRSYMDSEIRAIMAQYMPLDSQN+V +HL ED Sbjct: 591 RLRSYMDSEIRAIMAQYMPLDSQNDVHHHLQED 623 >ref|XP_002885935.1| VSR-2 [Arabidopsis lyrata subsp. lyrata] gi|297331775|gb|EFH62194.1| VSR-2 [Arabidopsis lyrata subsp. lyrata] Length = 627 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +2 Query: 2 RLRSYMDSEIRAIMAQYMPLDSQNEVQNHLNEDHA 106 RLR YMDSEIRAIMAQYMPLDSQ E+ NH N++HA Sbjct: 593 RLRQYMDSEIRAIMAQYMPLDSQPEIPNHANDEHA 627 >ref|XP_004289804.1| PREDICTED: vacuolar-sorting receptor 3-like [Fragaria vesca subsp. vesca] Length = 630 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +2 Query: 2 RLRSYMDSEIRAIMAQYMPLDSQNEVQNHLNEDHA 106 RLRSYMDSEIRAIMAQYMPLDSQ EV NH+N++ A Sbjct: 596 RLRSYMDSEIRAIMAQYMPLDSQAEVPNHVNDERA 630 >gb|EMJ00954.1| hypothetical protein PRUPE_ppa002822mg [Prunus persica] Length = 629 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +2 Query: 2 RLRSYMDSEIRAIMAQYMPLDSQNEVQNHLNEDHA 106 RLRSYMDSEIRAIMAQYMPLDSQ EV NH+N++ A Sbjct: 595 RLRSYMDSEIRAIMAQYMPLDSQAEVPNHVNDERA 629 >gb|AAF22842.1|AF209910_1 vacuolar sorting receptor protein [Prunus dulcis] Length = 159 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +2 Query: 2 RLRSYMDSEIRAIMAQYMPLDSQNEVQNHLNEDHA 106 RLRSYMDSEIRAIMAQYMPLDSQ EV NH+N++ A Sbjct: 125 RLRSYMDSEIRAIMAQYMPLDSQAEVPNHVNDERA 159 >ref|XP_003592523.1| Vacuolar-sorting receptor [Medicago truncatula] gi|355481571|gb|AES62774.1| Vacuolar-sorting receptor [Medicago truncatula] Length = 601 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +2 Query: 2 RLRSYMDSEIRAIMAQYMPLDSQNEVQNHLNEDHA 106 R+RSYMDSEIRAIMAQYMPLDSQ+EV NH+N++ A Sbjct: 567 RIRSYMDSEIRAIMAQYMPLDSQSEVVNHVNDERA 601 >ref|XP_002527509.1| zinc finger protein, putative [Ricinus communis] gi|223533149|gb|EEF34907.1| zinc finger protein, putative [Ricinus communis] Length = 633 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +2 Query: 2 RLRSYMDSEIRAIMAQYMPLDSQNEVQNHLNEDHA 106 RLRSYMDSEIRAIMAQYMPLDSQ EV NH+N++ A Sbjct: 599 RLRSYMDSEIRAIMAQYMPLDSQAEVPNHVNDERA 633 >gb|AEZ00905.1| putative BP-80 vacuolar sorting receptor protein, partial [Elaeis guineensis] Length = 243 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +2 Query: 2 RLRSYMDSEIRAIMAQYMPLDSQNEVQNHLNED 100 RLRSYMDSEIRAIMAQYMPLDSQ EV NH NE+ Sbjct: 208 RLRSYMDSEIRAIMAQYMPLDSQGEVPNHANEE 240 >gb|ESW15110.1| hypothetical protein PHAVU_007G045100g [Phaseolus vulgaris] Length = 630 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +2 Query: 2 RLRSYMDSEIRAIMAQYMPLDSQNEVQNHLNEDHA 106 R+RSYMDSEIRAIMAQYMPLDSQ+EV NH N++ A Sbjct: 596 RIRSYMDSEIRAIMAQYMPLDSQSEVVNHANDERA 630