BLASTX nr result
ID: Rehmannia23_contig00024969
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00024969 (988 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004246464.1| PREDICTED: uncharacterized protein LOC101265... 62 4e-07 ref|XP_006341060.1| PREDICTED: uncharacterized protein LOC102586... 61 6e-07 gb|EPS68092.1| hypothetical protein M569_06684 [Genlisea aurea] 59 2e-06 dbj|BAK07192.1| predicted protein [Hordeum vulgare subsp. vulgare] 59 4e-06 >ref|XP_004246464.1| PREDICTED: uncharacterized protein LOC101265360 [Solanum lycopersicum] Length = 287 Score = 61.6 bits (148), Expect = 4e-07 Identities = 33/65 (50%), Positives = 45/65 (69%), Gaps = 4/65 (6%) Frame = -2 Query: 513 PKHEPITTPTADLNLISAFKGSREKEGER----RVSWAPDVYDPPPTSDDHVAVSKTERH 346 P I++PTA L L+SA KGSREK+G+ V+WAPDVYDP PT+ HV + K +RH Sbjct: 124 PYSRSISSPTA-LKLVSAIKGSREKQGKPPKKLSVTWAPDVYDPIPTAASHVPI-KGQRH 181 Query: 345 KSEQK 331 +S+ + Sbjct: 182 RSDHR 186 >ref|XP_006341060.1| PREDICTED: uncharacterized protein LOC102586667 [Solanum tuberosum] Length = 289 Score = 61.2 bits (147), Expect = 6e-07 Identities = 33/65 (50%), Positives = 45/65 (69%), Gaps = 4/65 (6%) Frame = -2 Query: 513 PKHEPITTPTADLNLISAFKGSREKEGER----RVSWAPDVYDPPPTSDDHVAVSKTERH 346 P I++PTA L L+SA KGSREK+G+ V+WAPDVYDP PT+ HV +K +RH Sbjct: 126 PYSHSISSPTA-LTLVSAIKGSREKQGKPPKKLSVTWAPDVYDPIPTAVSHVP-NKVQRH 183 Query: 345 KSEQK 331 +S+ + Sbjct: 184 RSDHR 188 >gb|EPS68092.1| hypothetical protein M569_06684 [Genlisea aurea] Length = 154 Score = 59.3 bits (142), Expect = 2e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -2 Query: 471 LISAFKGSREKEGERRVSWAPDVYDPPPTSDDHVAVSK 358 L+SA KGSREK+G++ V+WAPDVYDP PTS HV +SK Sbjct: 80 LVSAIKGSREKQGKQSVTWAPDVYDPIPTSVSHVPLSK 117 >dbj|BAK07192.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 257 Score = 58.5 bits (140), Expect = 4e-06 Identities = 29/60 (48%), Positives = 37/60 (61%), Gaps = 7/60 (11%) Frame = -2 Query: 489 PTADLNLISAFKGSREKEGE-------RRVSWAPDVYDPPPTSDDHVAVSKTERHKSEQK 331 P+ L+SA KG RE+ G+ RRV+WAPDVYDPP TS DH S +R +S +K Sbjct: 110 PSTSRLLVSAMKGGRERSGKEASPTENRRVNWAPDVYDPPVTSVDHTLKSNQQRSRSRKK 169