BLASTX nr result
ID: Rehmannia23_contig00024947
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00024947 (508 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAZ07704.1| cytochrome P450 monooxygenase isoform I [Sesamum ... 59 5e-07 ref|XP_006853505.1| hypothetical protein AMTR_s00032p00218900 [A... 58 1e-06 ref|XP_002276576.1| PREDICTED: cytochrome P450 76C4 [Vitis vinif... 57 2e-06 ref|XP_002271420.2| PREDICTED: LOW QUALITY PROTEIN: cytochrome P... 56 4e-06 >gb|AAZ07704.1| cytochrome P450 monooxygenase isoform I [Sesamum indicum] Length = 499 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/38 (65%), Positives = 34/38 (89%) Frame = -3 Query: 503 NFGWELEESVKPQELDMNEKFGLTLQKAIPLKAVPTKL 390 +F W+LEE +KP+ +DM+E+FGLTLQKA+PL AVPT+L Sbjct: 462 SFDWKLEEGLKPEAVDMDERFGLTLQKAVPLVAVPTEL 499 >ref|XP_006853505.1| hypothetical protein AMTR_s00032p00218900 [Amborella trichopoda] gi|548857158|gb|ERN14972.1| hypothetical protein AMTR_s00032p00218900 [Amborella trichopoda] Length = 208 Score = 57.8 bits (138), Expect = 1e-06 Identities = 23/37 (62%), Positives = 32/37 (86%) Frame = -3 Query: 503 NFGWELEESVKPQELDMNEKFGLTLQKAIPLKAVPTK 393 +F WEL + +KP+E+DM +KFG+TLQKA+PL+AVP K Sbjct: 164 SFDWELPDGLKPEEMDMRDKFGVTLQKAVPLEAVPVK 200 >ref|XP_002276576.1| PREDICTED: cytochrome P450 76C4 [Vitis vinifera] Length = 499 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/37 (62%), Positives = 34/37 (91%) Frame = -3 Query: 503 NFGWELEESVKPQELDMNEKFGLTLQKAIPLKAVPTK 393 +F W+LE+S++P+++DM+EKFG TL+KA PL+AVPTK Sbjct: 462 SFDWKLEDSMRPEDMDMSEKFGFTLRKAQPLRAVPTK 498 >ref|XP_002271420.2| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 76C4-like [Vitis vinifera] Length = 498 Score = 56.2 bits (134), Expect = 4e-06 Identities = 21/38 (55%), Positives = 34/38 (89%) Frame = -3 Query: 503 NFGWELEESVKPQELDMNEKFGLTLQKAIPLKAVPTKL 390 +F W+LE+ +KP+++DM+EKFG+TLQKA PL+A+P ++ Sbjct: 461 SFDWKLEDGLKPEDMDMSEKFGITLQKAKPLRAIPIRI 498