BLASTX nr result
ID: Rehmannia23_contig00024563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00024563 (316 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67705.1| hypothetical protein M569_07067 [Genlisea aurea] 64 3e-08 gb|EOY08904.1| Peptidyl-tRNA hydrolase family protein isoform 3 ... 61 2e-07 gb|EOY08903.1| Peptidyl-tRNA hydrolase family protein isoform 2 ... 61 2e-07 gb|EOY08902.1| Peptidyl-tRNA hydrolase family protein isoform 1 ... 61 2e-07 ref|XP_002532065.1| peptidyl-tRNA hydrolase, putative [Ricinus c... 60 3e-07 ref|XP_006339857.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 59 7e-07 ref|XP_006339856.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 59 7e-07 ref|XP_004231873.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 59 7e-07 ref|NP_001239948.1| uncharacterized protein LOC100808506 [Glycin... 57 3e-06 ref|XP_002283606.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 57 3e-06 ref|XP_006488925.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 56 4e-06 ref|XP_006445605.1| hypothetical protein CICLE_v10016635mg [Citr... 56 4e-06 ref|XP_006445603.1| hypothetical protein CICLE_v10016635mg [Citr... 56 4e-06 ref|XP_006445602.1| hypothetical protein CICLE_v10016635mg [Citr... 56 4e-06 gb|EXC34495.1| Peptidyl-tRNA hydrolase [Morus notabilis] 55 7e-06 ref|XP_004159345.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 55 1e-05 ref|XP_004144076.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 55 1e-05 >gb|EPS67705.1| hypothetical protein M569_07067 [Genlisea aurea] Length = 220 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 1 EGVDALIQVLSKGLTESARCFNTEQKYKHIRLQTMPV 111 EGVDAL V+S+G TESA+CFN +QKYKHIRLQTMPV Sbjct: 184 EGVDALKAVISEGFTESAKCFNKQQKYKHIRLQTMPV 220 >gb|EOY08904.1| Peptidyl-tRNA hydrolase family protein isoform 3 [Theobroma cacao] Length = 214 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +1 Query: 1 EGVDALIQVLSKGLTESARCFNTEQKYKHIRLQTMP 108 EGVDAL +LSKG TESAR FN EQKYKHIRLQTMP Sbjct: 178 EGVDALKLLLSKGFTESARRFNAEQKYKHIRLQTMP 213 >gb|EOY08903.1| Peptidyl-tRNA hydrolase family protein isoform 2 [Theobroma cacao] Length = 224 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +1 Query: 1 EGVDALIQVLSKGLTESARCFNTEQKYKHIRLQTMP 108 EGVDAL +LSKG TESAR FN EQKYKHIRLQTMP Sbjct: 188 EGVDALKLLLSKGFTESARRFNAEQKYKHIRLQTMP 223 >gb|EOY08902.1| Peptidyl-tRNA hydrolase family protein isoform 1 [Theobroma cacao] Length = 263 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +1 Query: 1 EGVDALIQVLSKGLTESARCFNTEQKYKHIRLQTMP 108 EGVDAL +LSKG TESAR FN EQKYKHIRLQTMP Sbjct: 227 EGVDALKLLLSKGFTESARRFNAEQKYKHIRLQTMP 262 >ref|XP_002532065.1| peptidyl-tRNA hydrolase, putative [Ricinus communis] gi|223528269|gb|EEF30320.1| peptidyl-tRNA hydrolase, putative [Ricinus communis] Length = 217 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 1 EGVDALIQVLSKGLTESARCFNTEQKYKHIRLQTMP 108 EG AL +L KGLTE+ARCFN EQKYKHIRLQTMP Sbjct: 181 EGAAALKSILFKGLTETARCFNQEQKYKHIRLQTMP 216 >ref|XP_006339857.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial-like isoform X2 [Solanum tuberosum] gi|565345548|ref|XP_006339858.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial-like isoform X3 [Solanum tuberosum] Length = 220 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 1 EGVDALIQVLSKGLTESARCFNTEQKYKHIRLQTMP 108 EG AL QVLSKG +ES+ CFNT QKYKHIRLQT+P Sbjct: 184 EGAHALEQVLSKGFSESSNCFNTTQKYKHIRLQTLP 219 >ref|XP_006339856.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial-like isoform X1 [Solanum tuberosum] Length = 247 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 1 EGVDALIQVLSKGLTESARCFNTEQKYKHIRLQTMP 108 EG AL QVLSKG +ES+ CFNT QKYKHIRLQT+P Sbjct: 211 EGAHALEQVLSKGFSESSNCFNTTQKYKHIRLQTLP 246 >ref|XP_004231873.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial-like [Solanum lycopersicum] Length = 220 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 1 EGVDALIQVLSKGLTESARCFNTEQKYKHIRLQTMP 108 EG AL QVLSKG +ES+ CFNT QKYKHIRLQT+P Sbjct: 184 EGAHALEQVLSKGFSESSNCFNTTQKYKHIRLQTLP 219 >ref|NP_001239948.1| uncharacterized protein LOC100808506 [Glycine max] gi|571469106|ref|XP_006584596.1| PREDICTED: uncharacterized protein LOC100808506 isoform X1 [Glycine max] gi|255645293|gb|ACU23143.1| unknown [Glycine max] Length = 218 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +1 Query: 1 EGVDALIQVLSKGLTESARCFNTEQKYKHIRLQTMPV 111 EG+DAL +LSKGLTESA+ FN EQKYKH+R+Q +PV Sbjct: 181 EGIDALKLLLSKGLTESAKRFNKEQKYKHLRVQNLPV 217 >ref|XP_002283606.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial [Vitis vinifera] gi|297746470|emb|CBI16526.3| unnamed protein product [Vitis vinifera] Length = 217 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +1 Query: 1 EGVDALIQVLSKGLTESARCFNTEQKYKHIRLQTM 105 EGV L + SKGLTESARCFNTEQKYKHIR+Q M Sbjct: 181 EGVGVLKLLSSKGLTESARCFNTEQKYKHIRVQNM 215 >ref|XP_006488925.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial-like isoform X3 [Citrus sinensis] Length = 209 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 1 EGVDALIQVLSKGLTESARCFNTEQKYKHIRLQTMP 108 EGV+ L +LSKGLTESAR FNT QKYKHIRLQ MP Sbjct: 173 EGVEVLKLLLSKGLTESARHFNTIQKYKHIRLQNMP 208 >ref|XP_006445605.1| hypothetical protein CICLE_v10016635mg [Citrus clementina] gi|568871509|ref|XP_006488926.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial-like isoform X4 [Citrus sinensis] gi|557548216|gb|ESR58845.1| hypothetical protein CICLE_v10016635mg [Citrus clementina] Length = 208 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 1 EGVDALIQVLSKGLTESARCFNTEQKYKHIRLQTMP 108 EGV+ L +LSKGLTESAR FNT QKYKHIRLQ MP Sbjct: 172 EGVEVLKLLLSKGLTESARHFNTIQKYKHIRLQNMP 207 >ref|XP_006445603.1| hypothetical protein CICLE_v10016635mg [Citrus clementina] gi|567906585|ref|XP_006445606.1| hypothetical protein CICLE_v10016635mg [Citrus clementina] gi|568871505|ref|XP_006488924.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial-like isoform X2 [Citrus sinensis] gi|557548214|gb|ESR58843.1| hypothetical protein CICLE_v10016635mg [Citrus clementina] gi|557548217|gb|ESR58846.1| hypothetical protein CICLE_v10016635mg [Citrus clementina] Length = 218 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 1 EGVDALIQVLSKGLTESARCFNTEQKYKHIRLQTMP 108 EGV+ L +LSKGLTESAR FNT QKYKHIRLQ MP Sbjct: 182 EGVEVLKLLLSKGLTESARHFNTIQKYKHIRLQNMP 217 >ref|XP_006445602.1| hypothetical protein CICLE_v10016635mg [Citrus clementina] gi|567906587|ref|XP_006445607.1| hypothetical protein CICLE_v10016635mg [Citrus clementina] gi|568871503|ref|XP_006488923.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial-like isoform X1 [Citrus sinensis] gi|557548213|gb|ESR58842.1| hypothetical protein CICLE_v10016635mg [Citrus clementina] gi|557548218|gb|ESR58847.1| hypothetical protein CICLE_v10016635mg [Citrus clementina] Length = 219 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 1 EGVDALIQVLSKGLTESARCFNTEQKYKHIRLQTMP 108 EGV+ L +LSKGLTESAR FNT QKYKHIRLQ MP Sbjct: 183 EGVEVLKLLLSKGLTESARHFNTIQKYKHIRLQNMP 218 >gb|EXC34495.1| Peptidyl-tRNA hydrolase [Morus notabilis] Length = 218 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +1 Query: 1 EGVDALIQVLSKGLTESARCFNTEQKYKHIRLQTMP 108 EGVD L +L++GLTESAR FN EQKYKH+R+QT+P Sbjct: 182 EGVDILKYLLARGLTESARRFNVEQKYKHLRVQTLP 217 >ref|XP_004159345.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial-like [Cucumis sativus] Length = 218 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 1 EGVDALIQVLSKGLTESARCFNTEQKYKHIRLQTMPV 111 EGV AL +LS GL+ESAR FN +QKYKHIRLQTMPV Sbjct: 182 EGVGALKLLLSHGLSESARHFNHKQKYKHIRLQTMPV 218 >ref|XP_004144076.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial-like [Cucumis sativus] Length = 218 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 1 EGVDALIQVLSKGLTESARCFNTEQKYKHIRLQTMPV 111 EGV AL +LS GL+ESAR FN +QKYKHIRLQTMPV Sbjct: 182 EGVGALKLLLSHGLSESARHFNHKQKYKHIRLQTMPV 218