BLASTX nr result
ID: Rehmannia23_contig00024338
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00024338 (390 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS58485.1| hypothetical protein M569_16329, partial [Genlise... 61 2e-07 ref|XP_002519948.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 ref|XP_002329190.1| predicted protein [Populus trichocarpa] 57 3e-06 >gb|EPS58485.1| hypothetical protein M569_16329, partial [Genlisea aurea] Length = 129 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = +2 Query: 11 VPLQNEIGDLVDELVVNTKKLIQATSREVDKWRR 112 VPLQ++IG ++DELVVNTKKLI+ATSRE+DKWRR Sbjct: 96 VPLQDDIGGVIDELVVNTKKLIEATSREMDKWRR 129 >ref|XP_002519948.1| conserved hypothetical protein [Ricinus communis] gi|223540994|gb|EEF42552.1| conserved hypothetical protein [Ricinus communis] Length = 140 Score = 57.8 bits (138), Expect = 1e-06 Identities = 23/36 (63%), Positives = 33/36 (91%) Frame = +2 Query: 5 GDVPLQNEIGDLVDELVVNTKKLIQATSREVDKWRR 112 G++P Q+E+ L+DELV+NTKKL+QATSRE++KWR+ Sbjct: 105 GNLPTQDEMAGLIDELVINTKKLVQATSREIEKWRK 140 >ref|XP_002329190.1| predicted protein [Populus trichocarpa] Length = 141 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/35 (62%), Positives = 32/35 (91%) Frame = +2 Query: 8 DVPLQNEIGDLVDELVVNTKKLIQATSREVDKWRR 112 ++P +E+G L+DELV+NTKKL++ATSRE++KWRR Sbjct: 107 NLPTHDEVGSLIDELVINTKKLVKATSREIEKWRR 141