BLASTX nr result
ID: Rehmannia23_contig00024118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00024118 (410 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006348427.1| PREDICTED: uncharacterized protein LOC102594... 70 3e-10 ref|XP_004228917.1| PREDICTED: uncharacterized protein LOC101264... 70 3e-10 >ref|XP_006348427.1| PREDICTED: uncharacterized protein LOC102594000 [Solanum tuberosum] Length = 159 Score = 70.1 bits (170), Expect = 3e-10 Identities = 38/54 (70%), Positives = 43/54 (79%), Gaps = 2/54 (3%) Frame = +3 Query: 255 MPRQIVLRAPPS-AVDRR-QPLLQSSDYSSRGGTRTVRVAEVAGGTMAECAAVC 410 M +QIVLRAP S ++DRR QPLL + D SSRGG R R+AEVAGGT AECAAVC Sbjct: 1 MTKQIVLRAPSSLSIDRRRQPLLSNQDTSSRGGVRKARLAEVAGGTAAECAAVC 54 >ref|XP_004228917.1| PREDICTED: uncharacterized protein LOC101264148 [Solanum lycopersicum] Length = 159 Score = 70.1 bits (170), Expect = 3e-10 Identities = 38/54 (70%), Positives = 43/54 (79%), Gaps = 2/54 (3%) Frame = +3 Query: 255 MPRQIVLRAPPS-AVDRR-QPLLQSSDYSSRGGTRTVRVAEVAGGTMAECAAVC 410 M +QIVLRAP S ++DRR QPLL + D SSRGG R R+AEVAGGT AECAAVC Sbjct: 1 MTKQIVLRAPSSLSIDRRRQPLLSNQDTSSRGGVRKARLAEVAGGTTAECAAVC 54