BLASTX nr result
ID: Rehmannia23_contig00023467
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00023467 (482 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006345366.1| PREDICTED: cell division control protein 48 ... 103 3e-20 ref|XP_004229290.1| PREDICTED: cell division control protein 48 ... 100 2e-19 gb|EOY04928.1| Cell division control protein 48 C isoform 1 [The... 97 2e-18 ref|XP_004156006.1| PREDICTED: LOW QUALITY PROTEIN: cell divisio... 97 3e-18 ref|XP_004146387.1| PREDICTED: cell division control protein 48 ... 97 3e-18 gb|EOY11871.1| Cell division control protein 48 C isoform 2 [The... 95 8e-18 gb|EOY11870.1| Cell division control protein 48 C isoform 1 [The... 95 8e-18 ref|XP_006351196.1| PREDICTED: cell division control protein 48 ... 95 1e-17 emb|CBI27563.3| unnamed protein product [Vitis vinifera] 94 2e-17 ref|XP_002266185.1| PREDICTED: cell division control protein 48 ... 94 2e-17 gb|EMJ12545.1| hypothetical protein PRUPE_ppa001430mg [Prunus pe... 93 3e-17 gb|EMJ00129.1| hypothetical protein PRUPE_ppa001288mg [Prunus pe... 91 2e-16 ref|XP_002522707.1| Protein cdcH, putative [Ricinus communis] gi... 89 8e-16 gb|EMJ08201.1| hypothetical protein PRUPE_ppb022122mg, partial [... 88 1e-15 ref|XP_004485498.1| PREDICTED: cell division control protein 48 ... 88 1e-15 ref|XP_004485496.1| PREDICTED: cell division control protein 48 ... 88 1e-15 ref|XP_003593030.1| Cell division control protein-like protein [... 86 4e-15 gb|ESW20508.1| hypothetical protein PHAVU_006G215100g [Phaseolus... 86 5e-15 ref|XP_006431431.1| hypothetical protein CICLE_v10000344mg [Citr... 86 5e-15 ref|XP_003531589.1| PREDICTED: cell division control protein 48 ... 86 5e-15 >ref|XP_006345366.1| PREDICTED: cell division control protein 48 homolog C-like [Solanum tuberosum] Length = 822 Score = 103 bits (256), Expect = 3e-20 Identities = 54/100 (54%), Positives = 72/100 (72%), Gaps = 5/100 (5%) Frame = +3 Query: 3 ILKALARNKLIDANVDLMAIGNDTACDNFSGSDLSALISEATLTAIEEQ-----SSNGSC 167 ILKALAR K ID++VDLM IG D AC NFSG+DL+AL++EA + A+E++ + G Sbjct: 723 ILKALARKKPIDSSVDLMTIGRDDACKNFSGADLAALMNEAAMVALEDKLTAMATGCGDG 782 Query: 168 SIPCFTKDAHFKKALKKISPSVSKEQIKYYNLLSKTLKAS 287 K++HFK+AL+K+SPSVS EQI+YY LSK +AS Sbjct: 783 DTSSIIKESHFKRALEKVSPSVSNEQIQYYQELSKHFRAS 822 >ref|XP_004229290.1| PREDICTED: cell division control protein 48 homolog C-like [Solanum lycopersicum] Length = 821 Score = 100 bits (249), Expect = 2e-19 Identities = 54/98 (55%), Positives = 72/98 (73%), Gaps = 3/98 (3%) Frame = +3 Query: 3 ILKALARNKLIDANVDLMAIGNDTACDNFSGSDLSALISEATLTAIEEQ--SSNGSC-SI 173 ILKALAR K +D++VDLM IG D AC NFSG+DL+AL++EA + A+E++ + SC Sbjct: 724 ILKALARKKPVDSSVDLMTIGRDDACKNFSGADLAALMNEAAMVALEDKLTAMATSCDDT 783 Query: 174 PCFTKDAHFKKALKKISPSVSKEQIKYYNLLSKTLKAS 287 K++HFK AL+K+SPSVS EQIKYY LSK +A+ Sbjct: 784 SSVIKESHFKCALEKVSPSVSNEQIKYYQELSKHFRAA 821 >gb|EOY04928.1| Cell division control protein 48 C isoform 1 [Theobroma cacao] gi|508713032|gb|EOY04929.1| Cell division control protein 48 C isoform 1 [Theobroma cacao] Length = 840 Score = 97.4 bits (241), Expect = 2e-18 Identities = 53/96 (55%), Positives = 72/96 (75%), Gaps = 1/96 (1%) Frame = +3 Query: 3 ILKALARNKLIDANVDLMAIGNDTACDNFSGSDLSALISEATLTAIEEQSSNGSCSIPCF 182 ILKALAR K IDA+VDL AIG ACDN SG+DLSAL++EA + A+EE+ ++ S + Sbjct: 745 ILKALARKKPIDASVDLSAIGRMDACDNLSGADLSALMNEAAMAALEEKLTSTGISDTSW 804 Query: 183 T-KDAHFKKALKKISPSVSKEQIKYYNLLSKTLKAS 287 T K HF++AL KISPSVS +Q ++Y +LS++ KA+ Sbjct: 805 TIKTFHFERALSKISPSVSDKQKQFYQVLSESFKAA 840 >ref|XP_004156006.1| PREDICTED: LOW QUALITY PROTEIN: cell division control protein 48 homolog C-like [Cucumis sativus] Length = 816 Score = 96.7 bits (239), Expect = 3e-18 Identities = 50/98 (51%), Positives = 72/98 (73%), Gaps = 3/98 (3%) Frame = +3 Query: 3 ILKALARNKLIDANVDLMAIGNDTACDNFSGSDLSALISEATLTAIEEQSSNGSCSI--- 173 +LKAL R K ID +VDL+AIG AC+NFSG+DL+AL++EA + A+EE+ + + +I Sbjct: 719 VLKALGRKKPIDVSVDLLAIGQMEACENFSGADLAALMNEAAMVALEEKLTLDNSNIESA 778 Query: 174 PCFTKDAHFKKALKKISPSVSKEQIKYYNLLSKTLKAS 287 C K HF++ L KISPSVS++Q +Y +LSK+LKA+ Sbjct: 779 SCTIKMVHFERGLTKISPSVSEKQKHFYEILSKSLKAA 816 >ref|XP_004146387.1| PREDICTED: cell division control protein 48 homolog C-like [Cucumis sativus] Length = 816 Score = 96.7 bits (239), Expect = 3e-18 Identities = 50/98 (51%), Positives = 72/98 (73%), Gaps = 3/98 (3%) Frame = +3 Query: 3 ILKALARNKLIDANVDLMAIGNDTACDNFSGSDLSALISEATLTAIEEQSSNGSCSI--- 173 +LKAL R K ID +VDL+AIG AC+NFSG+DL+AL++EA + A+EE+ + + +I Sbjct: 719 VLKALGRKKPIDVSVDLLAIGQMEACENFSGADLAALMNEAAMAALEEKLTLDNSNIESA 778 Query: 174 PCFTKDAHFKKALKKISPSVSKEQIKYYNLLSKTLKAS 287 C K HF++ L KISPSVS++Q +Y +LSK+LKA+ Sbjct: 779 SCTIKMVHFERGLTKISPSVSEKQKHFYEILSKSLKAA 816 >gb|EOY11871.1| Cell division control protein 48 C isoform 2 [Theobroma cacao] Length = 798 Score = 95.1 bits (235), Expect = 8e-18 Identities = 51/96 (53%), Positives = 70/96 (72%), Gaps = 1/96 (1%) Frame = +3 Query: 3 ILKALARNKLIDANVDLMAIGNDTACDNFSGSDLSALISEATLTAIEEQ-SSNGSCSIPC 179 ILKALAR K IDA+VDL A+G AC+N SG+DLSAL++EA + A+EE+ +S G Sbjct: 703 ILKALARKKPIDASVDLSALGRMEACENLSGADLSALMNEAAMAALEEKLTSTGISETSL 762 Query: 180 FTKDAHFKKALKKISPSVSKEQIKYYNLLSKTLKAS 287 K HF++AL KISPSVS +Q ++Y +LS++ KA+ Sbjct: 763 TIKTFHFERALSKISPSVSDKQKQFYQVLSESFKAA 798 >gb|EOY11870.1| Cell division control protein 48 C isoform 1 [Theobroma cacao] Length = 835 Score = 95.1 bits (235), Expect = 8e-18 Identities = 51/96 (53%), Positives = 70/96 (72%), Gaps = 1/96 (1%) Frame = +3 Query: 3 ILKALARNKLIDANVDLMAIGNDTACDNFSGSDLSALISEATLTAIEEQ-SSNGSCSIPC 179 ILKALAR K IDA+VDL A+G AC+N SG+DLSAL++EA + A+EE+ +S G Sbjct: 740 ILKALARKKPIDASVDLSALGRMEACENLSGADLSALMNEAAMAALEEKLTSTGISETSL 799 Query: 180 FTKDAHFKKALKKISPSVSKEQIKYYNLLSKTLKAS 287 K HF++AL KISPSVS +Q ++Y +LS++ KA+ Sbjct: 800 TIKTFHFERALSKISPSVSDKQKQFYQVLSESFKAA 835 >ref|XP_006351196.1| PREDICTED: cell division control protein 48 homolog C-like [Solanum tuberosum] Length = 773 Score = 94.7 bits (234), Expect = 1e-17 Identities = 50/98 (51%), Positives = 69/98 (70%), Gaps = 3/98 (3%) Frame = +3 Query: 3 ILKALARNKLIDANVDLMAIGNDTACDNFSGSDLSALISEATLTAIEEQSS---NGSCSI 173 ILKALAR K ID++VDL++IG + AC FSG+DLS+L++EA + A+E+ + G Sbjct: 676 ILKALARKKPIDSSVDLVSIGRNNACKRFSGADLSSLMNEAAMLALEDTLAAIDTGCGDT 735 Query: 174 PCFTKDAHFKKALKKISPSVSKEQIKYYNLLSKTLKAS 287 K++HF++ALKKISPSVS EQIKYY K +A+ Sbjct: 736 SSTIKESHFRRALKKISPSVSNEQIKYYKDFRKDFRAA 773 >emb|CBI27563.3| unnamed protein product [Vitis vinifera] Length = 769 Score = 94.0 bits (232), Expect = 2e-17 Identities = 52/95 (54%), Positives = 71/95 (74%), Gaps = 1/95 (1%) Frame = +3 Query: 3 ILKALARNKLIDANVDLMAIGNDTACDNFSGSDLSALISEATLTAIEEQSSNGSCSIPCF 182 ILKALAR K IDA+VDL+AIG AC+N SG+DLSAL++EA + A+EE+ ++ S + Sbjct: 674 ILKALARKKPIDASVDLIAIGQKEACNNLSGADLSALMNEAAMAALEEKLADCSSGAISW 733 Query: 183 TKDA-HFKKALKKISPSVSKEQIKYYNLLSKTLKA 284 T +A HF +AL KISPSVS +Q +Y +LS++ KA Sbjct: 734 TINAKHFDQALGKISPSVSNKQKHFYQVLSESFKA 768 >ref|XP_002266185.1| PREDICTED: cell division control protein 48 homolog C-like [Vitis vinifera] Length = 825 Score = 94.0 bits (232), Expect = 2e-17 Identities = 52/95 (54%), Positives = 71/95 (74%), Gaps = 1/95 (1%) Frame = +3 Query: 3 ILKALARNKLIDANVDLMAIGNDTACDNFSGSDLSALISEATLTAIEEQSSNGSCSIPCF 182 ILKALAR K IDA+VDL+AIG AC+N SG+DLSAL++EA + A+EE+ ++ S + Sbjct: 730 ILKALARKKPIDASVDLIAIGQKEACNNLSGADLSALMNEAAMAALEEKLADCSSGAISW 789 Query: 183 TKDA-HFKKALKKISPSVSKEQIKYYNLLSKTLKA 284 T +A HF +AL KISPSVS +Q +Y +LS++ KA Sbjct: 790 TINAKHFDQALGKISPSVSNKQKHFYQVLSESFKA 824 >gb|EMJ12545.1| hypothetical protein PRUPE_ppa001430mg [Prunus persica] Length = 830 Score = 93.2 bits (230), Expect = 3e-17 Identities = 49/98 (50%), Positives = 70/98 (71%), Gaps = 4/98 (4%) Frame = +3 Query: 3 ILKALARNKLIDANVDLMAIGNDTACDNFSGSDLSALISEATLTAIEEQSSN----GSCS 170 ILKALAR K IDA+VDL IG C+NFSG+DL+AL++EA + A+EE+ ++ S + Sbjct: 728 ILKALARKKPIDASVDLSEIGQRETCENFSGADLAALMNEAAMAALEEKLTSTPERNSDA 787 Query: 171 IPCFTKDAHFKKALKKISPSVSKEQIKYYNLLSKTLKA 284 P KD HF++AL KI+PSV+ +Q++YY ++LKA Sbjct: 788 SPWTIKDTHFEQALAKIAPSVTDKQMQYYQKFGESLKA 825 >gb|EMJ00129.1| hypothetical protein PRUPE_ppa001288mg [Prunus persica] Length = 862 Score = 90.9 bits (224), Expect = 2e-16 Identities = 48/97 (49%), Positives = 68/97 (70%), Gaps = 3/97 (3%) Frame = +3 Query: 3 ILKALARNKLIDANVDLMAIGNDTACDNFSGSDLSALISEATLTAIEEQSSNGSCSI--- 173 ILKALAR K IDA+VDL IG C+NFSG+DL+AL++EA + A+EE+ ++ S+ Sbjct: 761 ILKALARKKPIDASVDLSEIGQRGTCENFSGADLAALMNEAAMAALEEKLTSPERSLDAS 820 Query: 174 PCFTKDAHFKKALKKISPSVSKEQIKYYNLLSKTLKA 284 P D HF++AL KI+PSV+ Q++YY ++LKA Sbjct: 821 PWTINDTHFEQALAKIAPSVTDTQMQYYQKFGESLKA 857 >ref|XP_002522707.1| Protein cdcH, putative [Ricinus communis] gi|223538057|gb|EEF39669.1| Protein cdcH, putative [Ricinus communis] Length = 828 Score = 88.6 bits (218), Expect = 8e-16 Identities = 45/95 (47%), Positives = 63/95 (66%) Frame = +3 Query: 3 ILKALARNKLIDANVDLMAIGNDTACDNFSGSDLSALISEATLTAIEEQSSNGSCSIPCF 182 ILKALA+ K ID NVDL IG AC+N SG+DL L+ EA ++A+ E + S Sbjct: 734 ILKALAKGKPIDPNVDLSTIGKMEACENLSGADLKKLMDEAAMSALVEAKGSSSDESSST 793 Query: 183 TKDAHFKKALKKISPSVSKEQIKYYNLLSKTLKAS 287 K HF++AL KISPSVS +Q+KYY + S++ +++ Sbjct: 794 IKATHFEQALTKISPSVSHKQVKYYKVWSESFRSA 828 >gb|EMJ08201.1| hypothetical protein PRUPE_ppb022122mg, partial [Prunus persica] Length = 341 Score = 88.2 bits (217), Expect = 1e-15 Identities = 46/84 (54%), Positives = 61/84 (72%), Gaps = 2/84 (2%) Frame = +3 Query: 3 ILKALARNKLIDANVDLMAIGNDTACDNFSGSDLSALISEATLTAIEEQ--SSNGSCSIP 176 ILKALARNK ID+ VDL IG AC+NF+G+DL+AL+ EAT+ +EE+ S S S P Sbjct: 200 ILKALARNKPIDSRVDLSEIGQRNACENFTGADLAALMHEATMAPVEEKVTSIASSDSSP 259 Query: 177 CFTKDAHFKKALKKISPSVSKEQI 248 C K+ HF+KAL KI+PS++ E + Sbjct: 260 CTIKETHFEKALAKITPSLTDEPL 283 >ref|XP_004485498.1| PREDICTED: cell division control protein 48 homolog C-like isoform X3 [Cicer arietinum] Length = 799 Score = 87.8 bits (216), Expect = 1e-15 Identities = 47/96 (48%), Positives = 68/96 (70%), Gaps = 1/96 (1%) Frame = +3 Query: 3 ILKALARNKLIDANVDLMAIGNDTACDNFSGSDLSALISEATLTAIEEQSSNGSCSIPCF 182 IL+ALARNK ID++VDL IG AC+N SG+DL+ L++EA + A++E+ + + Sbjct: 704 ILEALARNKHIDSSVDLSVIGRMEACENLSGADLAELMNEAVMAALDEKLDSTETTNDTL 763 Query: 183 T-KDAHFKKALKKISPSVSKEQIKYYNLLSKTLKAS 287 T + +HF+ AL K+SPSVS +Q KYY LLS+ KA+ Sbjct: 764 TIRASHFEVALSKVSPSVSDKQRKYYQLLSEKNKAA 799 >ref|XP_004485496.1| PREDICTED: cell division control protein 48 homolog C-like isoform X1 [Cicer arietinum] Length = 819 Score = 87.8 bits (216), Expect = 1e-15 Identities = 47/96 (48%), Positives = 68/96 (70%), Gaps = 1/96 (1%) Frame = +3 Query: 3 ILKALARNKLIDANVDLMAIGNDTACDNFSGSDLSALISEATLTAIEEQSSNGSCSIPCF 182 IL+ALARNK ID++VDL IG AC+N SG+DL+ L++EA + A++E+ + + Sbjct: 724 ILEALARNKHIDSSVDLSVIGRMEACENLSGADLAELMNEAVMAALDEKLDSTETTNDTL 783 Query: 183 T-KDAHFKKALKKISPSVSKEQIKYYNLLSKTLKAS 287 T + +HF+ AL K+SPSVS +Q KYY LLS+ KA+ Sbjct: 784 TIRASHFEVALSKVSPSVSDKQRKYYQLLSEKNKAA 819 >ref|XP_003593030.1| Cell division control protein-like protein [Medicago truncatula] gi|355482078|gb|AES63281.1| Cell division control protein-like protein [Medicago truncatula] Length = 806 Score = 86.3 bits (212), Expect = 4e-15 Identities = 47/100 (47%), Positives = 69/100 (69%), Gaps = 5/100 (5%) Frame = +3 Query: 3 ILKALARNKLIDANVDLMAIGNDTACDNFSGSDLSALISEATLTAIEEQSSNGSCSIPCF 182 ILKALARNK ID++VDL AIG AC+N SG+DL+ L++EA + A++E+ ++ + Sbjct: 707 ILKALARNKHIDSSVDLSAIGRMDACENLSGADLAELMNEAVMAALDEKLASIETTCDTL 766 Query: 183 T-----KDAHFKKALKKISPSVSKEQIKYYNLLSKTLKAS 287 T + +HF+ AL K SPSVS Q +YY L+++LKA+ Sbjct: 767 TDTLTIRTSHFEVALTKASPSVSATQREYYERLARSLKAA 806 >gb|ESW20508.1| hypothetical protein PHAVU_006G215100g [Phaseolus vulgaris] Length = 777 Score = 85.9 bits (211), Expect = 5e-15 Identities = 46/95 (48%), Positives = 60/95 (63%) Frame = +3 Query: 3 ILKALARNKLIDANVDLMAIGNDTACDNFSGSDLSALISEATLTAIEEQSSNGSCSIPCF 182 ILKALARNK IDA VDL A+ C+N SG+DL+AL++EA + A+EE+ Sbjct: 691 ILKALARNKAIDATVDLSAMATMAGCENLSGADLAALMNEAAMAAVEEKHKT-------- 742 Query: 183 TKDAHFKKALKKISPSVSKEQIKYYNLLSKTLKAS 287 HF+ AL K+SPSVS Q KYY LS++ K + Sbjct: 743 INSTHFEVALSKVSPSVSDRQKKYYQHLSESFKVA 777 >ref|XP_006431431.1| hypothetical protein CICLE_v10000344mg [Citrus clementina] gi|557533553|gb|ESR44671.1| hypothetical protein CICLE_v10000344mg [Citrus clementina] Length = 784 Score = 85.9 bits (211), Expect = 5e-15 Identities = 49/98 (50%), Positives = 68/98 (69%), Gaps = 3/98 (3%) Frame = +3 Query: 3 ILKALARNKLIDANVDLMAIGNDTACDNFSGSDLSALISEATLTAIEEQ--SSNGSCSIP 176 IL+ALAR K ID +VDL I C+N SG+DL+A+++EA + A+E++ SS S + Sbjct: 687 ILEALARKKPIDDSVDLHTIAQSKFCENLSGADLAAMMNEAAMAALEDKLISSKSSSDVT 746 Query: 177 CFT-KDAHFKKALKKISPSVSKEQIKYYNLLSKTLKAS 287 FT K HF++AL KISPSVS+ QI+ Y LS+T KA+ Sbjct: 747 PFTIKLTHFEQALSKISPSVSELQIQRYKTLSETFKAA 784 >ref|XP_003531589.1| PREDICTED: cell division control protein 48 homolog C-like isoform X1 [Glycine max] Length = 791 Score = 85.9 bits (211), Expect = 5e-15 Identities = 48/100 (48%), Positives = 66/100 (66%), Gaps = 5/100 (5%) Frame = +3 Query: 3 ILKALARNKLIDANVDLMAIGNDTACDNFSGSDLSALISEATLTAIEEQSSNGSCSIPCF 182 ILKALAR K +DA+VDL AI AC+N SG+DL+AL++EA + A+EE+ ++ + Sbjct: 692 ILKALARKKAVDASVDLSAIAKMEACENLSGADLAALMNEAAMAALEERLTSIETTCDTL 751 Query: 183 T-----KDAHFKKALKKISPSVSKEQIKYYNLLSKTLKAS 287 T K HF+ AL K+SPSVS Q +YY LS+ KA+ Sbjct: 752 TIKRTIKRHHFEVALSKVSPSVSDRQKQYYQHLSEGFKAA 791