BLASTX nr result
ID: Rehmannia23_contig00023336
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00023336 (383 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS66352.1| hypothetical protein M569_08432, partial [Genlise... 77 2e-12 >gb|EPS66352.1| hypothetical protein M569_08432, partial [Genlisea aurea] Length = 172 Score = 77.4 bits (189), Expect = 2e-12 Identities = 42/73 (57%), Positives = 50/73 (68%), Gaps = 1/73 (1%) Frame = -2 Query: 304 MPISGQEVHRHLHHHAPPQYLTRGQR-KLLLFFLKCIIMVAVISLFLFFLGFVAIVLLCF 128 MPI G+E R PP+Y RGQ+ KLL+F L+CI+M ISLFLFFLGF A VL+ F Sbjct: 1 MPIPGEETRRQ---QPPPEYHFRGQKSKLLIFLLQCIVMFFAISLFLFFLGFAAFVLIHF 57 Query: 127 VFLSNTVSRRCTR 89 +FLSNT RR R Sbjct: 58 LFLSNTYRRRFRR 70