BLASTX nr result
ID: Rehmannia23_contig00023009
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00023009 (327 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004235983.1| PREDICTED: two-component response regulator-... 56 6e-06 >ref|XP_004235983.1| PREDICTED: two-component response regulator-like APRR1-like [Solanum lycopersicum] Length = 553 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/52 (57%), Positives = 31/52 (59%) Frame = -3 Query: 325 LRGQFVRKVNGVNVDLNGHPASAXXXXXXXXXXXXXDQSNMDFLPEDDASEC 170 +RGQFVRKVNGVNVDLNGHPASA N D PEDD S C Sbjct: 502 VRGQFVRKVNGVNVDLNGHPASADYDVDEEEEDEEEQTGNFD-SPEDDPSMC 552