BLASTX nr result
ID: Rehmannia23_contig00022314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00022314 (346 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006344772.1| PREDICTED: tip elongation aberrant protein 1... 57 2e-06 >ref|XP_006344772.1| PREDICTED: tip elongation aberrant protein 1-like [Solanum tuberosum] Length = 654 Score = 57.4 bits (137), Expect = 2e-06 Identities = 41/104 (39%), Positives = 52/104 (50%), Gaps = 6/104 (5%) Frame = -1 Query: 346 VLFSPGPDLVSRGAIRGQHPISVTHPISVNRANSGENYSNVAYPRHFHQQPVKLLAPSEQ 167 VLF+P PDLV RG + GQ+P I VN AN N+ ++ R QQ V++ P Sbjct: 546 VLFAPAPDLVPRGPVLGQNPSPSPGHIGVNYANIHTNHISLGCRRQ-PQQLVQMQVPELG 604 Query: 166 TQSRKSPPENRVTLPFGKDS------IRAKSELHGVVLTLASPG 53 QS P R T + S + +SEL GVVLTL PG Sbjct: 605 RQSIGKVPIRRSTSSVMRSSHQLEKDTQKRSELEGVVLTLGGPG 648