BLASTX nr result
ID: Rehmannia23_contig00021460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00021460 (650 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631475.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 ref|XP_006343097.1| PREDICTED: protein Rf1, mitochondrial-like [... 65 2e-08 ref|XP_004236403.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 gb|EOY25154.1| Tetratricopeptide repeat-like superfamily protein... 64 5e-08 gb|ESW30266.1| hypothetical protein PHAVU_002G138600g [Phaseolus... 60 4e-07 ref|XP_006572968.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|XP_004512504.1| PREDICTED: putative pentatricopeptide repeat... 58 2e-06 ref|XP_006368375.1| hypothetical protein POPTR_0001s02170g [Popu... 57 4e-06 ref|XP_002326536.1| predicted protein [Populus trichocarpa] 57 4e-06 >ref|XP_003631475.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Vitis vinifera] gi|297742067|emb|CBI33854.3| unnamed protein product [Vitis vinifera] Length = 767 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/59 (54%), Positives = 42/59 (71%) Frame = -1 Query: 179 LFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYALLR 3 L VV+V KSLNWE++R + F+ T+ KYGF +S+ AF+ V V A A M +EVYALLR Sbjct: 90 LSPVVVKVFKSLNWEVARHIKFSTTMKKYGFSRSIDAFRTVVNVLALAGMHMEVYALLR 148 >ref|XP_006343097.1| PREDICTED: protein Rf1, mitochondrial-like [Solanum tuberosum] Length = 756 Score = 65.1 bits (157), Expect = 2e-08 Identities = 46/143 (32%), Positives = 70/143 (48%), Gaps = 2/143 (1%) Frame = -1 Query: 425 MGACFFPTNYSFSLKFGISRQLNFLRRWITVKDCSFLCNKYRR--VSAVPLLDDSDYYXX 252 MG P SFSL F +L F K+ LC KY S++PLL DSD Sbjct: 1 MGLGLLPRK-SFSLLFKDLHELGFF------KEQRSLCRKYYHGASSSLPLLYDSD---- 49 Query: 251 XXXXXXXXXXNFLRESNRELKSVELFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLM 72 ++ K +++S VV V KSL+WE+++++ F +++ YG S+ Sbjct: 50 --------KAVIPTRNSLNWKGRKVYSVVVTVCKSLSWEVAKEIPFEKSLKNYGLYHSIS 101 Query: 71 AFKMFVKVYACAEMQLEVYALLR 3 ++M + +A A M LEVY LL+ Sbjct: 102 GYRMMIHTFAFAGMDLEVYTLLK 124 >ref|XP_004236403.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Solanum lycopersicum] Length = 784 Score = 64.3 bits (155), Expect = 3e-08 Identities = 46/143 (32%), Positives = 70/143 (48%), Gaps = 2/143 (1%) Frame = -1 Query: 425 MGACFFPTNYSFSLKFGISRQLNFLRRWITVKDCSFLCNKYRR--VSAVPLLDDSDYYXX 252 MG P SFSL F +L F K+ LC KY S++PLL DSD Sbjct: 1 MGLGLLPRK-SFSLLFKHLHKLGFF------KEQRSLCRKYYHGASSSLPLLYDSD---- 49 Query: 251 XXXXXXXXXXNFLRESNRELKSVELFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLM 72 ++ K +++S VVRV KSL+W++ R++ F ++ KYG S+ Sbjct: 50 --------KAVIPTRNSLNWKGRKVYSVVVRVCKSLSWKVVREISFVESLAKYGLYHSIN 101 Query: 71 AFKMFVKVYACAEMQLEVYALLR 3 ++M + +A A M +EV+ LL+ Sbjct: 102 GYRMIIHTFAFAGMDMEVHTLLK 124 >gb|EOY25154.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 746 Score = 63.5 bits (153), Expect = 5e-08 Identities = 28/55 (50%), Positives = 40/55 (72%) Frame = -1 Query: 167 VVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYALLR 3 VVRV KSLNW+I+R++ F YGFD S+ AF++ + ++A A MQ+E +ALLR Sbjct: 81 VVRVFKSLNWDIAREIRFNMAAKMYGFDHSMYAFRIIIHIFAMAGMQMEAHALLR 135 >gb|ESW30266.1| hypothetical protein PHAVU_002G138600g [Phaseolus vulgaris] Length = 831 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/60 (48%), Positives = 41/60 (68%) Frame = -1 Query: 182 ELFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYALLR 3 E F V RVLKSL+W ++R+V F V+ +GF S+ F++ V +A A M+LEV+ALLR Sbjct: 63 EYFPLVSRVLKSLSWRVAREVRFGSWVESHGFSHSINCFRIIVHAFALAGMRLEVFALLR 122 >ref|XP_006572968.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like isoform X1 [Glycine max] gi|571433663|ref|XP_006572969.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like isoform X2 [Glycine max] gi|571433665|ref|XP_006572970.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like isoform X3 [Glycine max] gi|571433667|ref|XP_006572971.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like isoform X4 [Glycine max] Length = 734 Score = 59.3 bits (142), Expect = 9e-07 Identities = 29/60 (48%), Positives = 40/60 (66%) Frame = -1 Query: 182 ELFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYALLR 3 ELF V RV KSL+W ++RK F V+ +GF S+ F++ V +A A M+LEV+ALLR Sbjct: 64 ELFPLVSRVFKSLSWSVARKKKFGNWVECHGFSHSISCFRIIVHAFALAGMRLEVWALLR 123 >ref|XP_004512504.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g02150-like isoform X1 [Cicer arietinum] gi|502162449|ref|XP_004512505.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g02150-like isoform X2 [Cicer arietinum] gi|502162452|ref|XP_004512506.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g02150-like isoform X3 [Cicer arietinum] Length = 666 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/62 (40%), Positives = 41/62 (66%) Frame = -1 Query: 188 SVELFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYAL 9 + +F VVRV K+LNW ++R++ F V +GF S+ +F++ + +A A M LEV+AL Sbjct: 46 NTRMFHLVVRVFKTLNWSVAREIRFKGWVQSHGFSHSINSFRIIIHTFAFAGMHLEVFAL 105 Query: 8 LR 3 +R Sbjct: 106 IR 107 >ref|XP_006368375.1| hypothetical protein POPTR_0001s02170g [Populus trichocarpa] gi|550346286|gb|ERP64944.1| hypothetical protein POPTR_0001s02170g [Populus trichocarpa] Length = 697 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/62 (46%), Positives = 42/62 (67%) Frame = -1 Query: 191 KSVELFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYA 12 K EL VV +LK+LNWE++R+V F+++V+ YGF S+ AF+ V V+A A +Q E Sbjct: 22 KRCELSRLVVELLKTLNWEVARQVKFSKSVNVYGFFYSINAFRTIVHVFALAGLQREAQY 81 Query: 11 LL 6 LL Sbjct: 82 LL 83 >ref|XP_002326536.1| predicted protein [Populus trichocarpa] Length = 697 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/62 (46%), Positives = 42/62 (67%) Frame = -1 Query: 191 KSVELFSAVVRVLKSLNWEISRKVCFARTVDKYGFDQSLMAFKMFVKVYACAEMQLEVYA 12 K EL VV +LK+LNWE++R+V F+++V+ YGF S+ AF+ V V+A A +Q E Sbjct: 22 KRCELSRLVVELLKTLNWEVARQVKFSKSVNVYGFFYSINAFRTIVHVFALAGLQREAQY 81 Query: 11 LL 6 LL Sbjct: 82 LL 83