BLASTX nr result
ID: Rehmannia23_contig00021382
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00021382 (380 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001275467.1| 1,4-alpha-glucan-branching enzyme 2-2, chlor... 62 1e-07 emb|CAB40748.1| starch branching enzyme II [Solanum tuberosum] 61 1e-07 emb|CAB40749.1| starch branching enzyme II [Solanum tuberosum] 61 1e-07 emb|CAB40743.1| starch branching enzyme II [Solanum tuberosum] 59 7e-07 ref|XP_004246561.1| PREDICTED: 1,4-alpha-glucan-branching enzyme... 57 3e-06 >ref|NP_001275467.1| 1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplastic-like [Solanum tuberosum] gi|4584509|emb|CAB40746.1| starch branching enzyme II [Solanum tuberosum] Length = 878 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/52 (63%), Positives = 39/52 (75%) Frame = -2 Query: 157 MVYTLPGVRLPTVPSAYKLSSNGWSSHVDTRNAHLSFFVKNKSNSRKIFSGK 2 MVYTL GVR PTVPS YK SNG+SS+ D RNA++S F+K S SRKI + K Sbjct: 1 MVYTLSGVRFPTVPSVYK--SNGFSSNGDRRNANISVFLKKHSLSRKILAEK 50 >emb|CAB40748.1| starch branching enzyme II [Solanum tuberosum] Length = 882 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/52 (63%), Positives = 39/52 (75%) Frame = -2 Query: 157 MVYTLPGVRLPTVPSAYKLSSNGWSSHVDTRNAHLSFFVKNKSNSRKIFSGK 2 MVYTL GVR PTVPS YK SNG+SS+ D RNA++S F+K S SRKI + K Sbjct: 1 MVYTLSGVRFPTVPSVYK--SNGFSSNGDRRNANVSVFLKKHSLSRKILAEK 50 >emb|CAB40749.1| starch branching enzyme II [Solanum tuberosum] Length = 433 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/52 (63%), Positives = 39/52 (75%) Frame = -2 Query: 157 MVYTLPGVRLPTVPSAYKLSSNGWSSHVDTRNAHLSFFVKNKSNSRKIFSGK 2 MVYTL GVR PTVPS YK SNG+SS+ D RNA++S F+K S SRKI + K Sbjct: 1 MVYTLSGVRFPTVPSVYK--SNGFSSNGDRRNANVSVFLKKHSLSRKILAEK 50 >emb|CAB40743.1| starch branching enzyme II [Solanum tuberosum] Length = 871 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = -2 Query: 157 MVYTLPGVRLPTVPSAYKLSSNGWSSHVDTRNAHLSFFVKNKSNSRKIFSGK 2 MVY L GVR PTVPS YK SNG+SS+ D RNA++S F+K S SRKI + K Sbjct: 1 MVYILSGVRFPTVPSVYK--SNGFSSNGDRRNANVSVFLKKHSLSRKILAEK 50 >ref|XP_004246561.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplastic-like [Solanum lycopersicum] Length = 876 Score = 56.6 bits (135), Expect = 3e-06 Identities = 33/53 (62%), Positives = 39/53 (73%), Gaps = 1/53 (1%) Frame = -2 Query: 157 MVYTLPGVRLPTVPSAYKLSSNGW-SSHVDTRNAHLSFFVKNKSNSRKIFSGK 2 MVYTL GVR PTVPS YK SNG+ SS+ D RNA++S F+K S SRKI + K Sbjct: 1 MVYTLSGVRFPTVPSVYK--SNGFTSSNGDRRNANVSVFLKKHSLSRKILAEK 51