BLASTX nr result
ID: Rehmannia23_contig00021326
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00021326 (443 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509829.1| conserved hypothetical protein [Ricinus comm... 77 2e-12 >ref|XP_002509829.1| conserved hypothetical protein [Ricinus communis] gi|223549728|gb|EEF51216.1| conserved hypothetical protein [Ricinus communis] Length = 358 Score = 77.4 bits (189), Expect = 2e-12 Identities = 41/133 (30%), Positives = 70/133 (52%), Gaps = 11/133 (8%) Frame = -1 Query: 425 FFRLRFGDGDKDNMIYHLYDETLLTYLG-----------KYGVLRTYQTKDNPPITSNFV 279 F R D N+++ YD TL ++ +Y + Q P T+N+V Sbjct: 55 FLRCYIIDRISKNILHERYDLTLQEWINHLKRETINPIARYPIPHR-QGPTIPSHTANYV 113 Query: 278 PKECRKIIRDMIRFVIFLHTQKKSLGGLSLDNLVVKGDLLKFWKIKFVKANDDTKRNDFS 99 P E RK+I+ M+ FV+ +H S G + N+V+K +++KFWK++F+ A+ +K NDF Sbjct: 114 PNEYRKLIKSMVTFVVDIHDAGYSTAGFGMPNIVIKNEVVKFWKVQFITASMGSKNNDFI 173 Query: 98 LLASILRELYEGQ 60 L ++ L+ G+ Sbjct: 174 CLHRVVESLFSGE 186