BLASTX nr result
ID: Rehmannia23_contig00020973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00020973 (397 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF98293.1| 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythrito... 99 6e-19 ref|XP_006470416.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-e... 96 5e-18 ref|XP_002523216.1| 4-diphosphocytidyl-2-C-methyl-d-erythritol k... 95 1e-17 gb|ABM89225.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase... 95 1e-17 gb|EMJ13549.1| hypothetical protein PRUPE_ppa006793mg [Prunus pe... 94 2e-17 ref|XP_002267319.2| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-e... 94 2e-17 ref|XP_006446412.1| hypothetical protein CICLE_v10015579mg [Citr... 93 4e-17 gb|EXB54665.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase... 92 5e-17 ref|XP_002298150.2| hypothetical protein POPTR_0001s23230g [Popu... 91 2e-16 gb|ABP96842.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase... 91 2e-16 gb|AAG01340.1|AF288615_1 4-diphosphocytidyl-2C-methyl-D-erythrit... 91 2e-16 gb|ABI35992.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase... 91 2e-16 ref|XP_006362734.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-e... 90 4e-16 ref|XP_004228879.1| PREDICTED: LOW QUALITY PROTEIN: 4-diphosphoc... 90 4e-16 gb|AAF76143.1|AF258339_1 4-diphosphocytidyl-2C-methyl-D-erythrit... 90 4e-16 sp|P93841.1|ISPE_SOLLC RecName: Full=4-diphosphocytidyl-2-C-meth... 90 4e-16 ref|XP_006294319.1| hypothetical protein CARUB_v10023327mg, part... 89 5e-16 ref|NP_180261.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol kina... 89 8e-16 sp|P56848.1|ISPE_MENPI RecName: Full=4-diphosphocytidyl-2-C-meth... 89 8e-16 gb|ABO87658.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase... 89 8e-16 >dbj|BAF98293.1| 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase [Hevea brasiliensis] gi|208429108|gb|ACI26723.1| 4-diphosphocytidyl-2C-methyl-D-erythritol kinase [Hevea brasiliensis] Length = 388 Score = 99.0 bits (245), Expect = 6e-19 Identities = 43/60 (71%), Positives = 51/60 (85%) Frame = -3 Query: 395 STIVGVGSPDPPQFVYDDDEYKDVFLSEANFITRPTNQWYTEPLSTDACTSPTGSSRSIE 216 STIVG+GSPDPPQF+YDDD+YKDVF+SEANF+TR NQWY EP ST C+S + S+SIE Sbjct: 329 STIVGIGSPDPPQFIYDDDDYKDVFVSEANFLTREANQWYKEPASTATCSSQSDRSQSIE 388 >ref|XP_006470416.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic/chromoplastic-like [Citrus sinensis] Length = 384 Score = 95.9 bits (237), Expect = 5e-18 Identities = 41/59 (69%), Positives = 49/59 (83%) Frame = -3 Query: 395 STIVGVGSPDPPQFVYDDDEYKDVFLSEANFITRPTNQWYTEPLSTDACTSPTGSSRSI 219 STIVG+GSPDPPQF+YDD+EY+DVFLSEA FITR NQWY EP ST+AC+ P S ++ Sbjct: 325 STIVGIGSPDPPQFIYDDNEYEDVFLSEARFITREVNQWYREPASTNACSEPPAFSETV 383 >ref|XP_002523216.1| 4-diphosphocytidyl-2-C-methyl-d-erythritol kinase, putative [Ricinus communis] gi|223537512|gb|EEF39137.1| 4-diphosphocytidyl-2-C-methyl-d-erythritol kinase, putative [Ricinus communis] Length = 388 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/60 (68%), Positives = 50/60 (83%) Frame = -3 Query: 395 STIVGVGSPDPPQFVYDDDEYKDVFLSEANFITRPTNQWYTEPLSTDACTSPTGSSRSIE 216 STIVG+GSPDPPQF+YDDD+YKDVF+SEANF+TR N+WY EP ST AC + + S+S E Sbjct: 329 STIVGIGSPDPPQFIYDDDDYKDVFVSEANFLTREANEWYKEPASTAACGTESDFSQSTE 388 >gb|ABM89225.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [Picrorhiza kurrooa] Length = 406 Score = 94.7 bits (234), Expect = 1e-17 Identities = 44/60 (73%), Positives = 50/60 (83%) Frame = -3 Query: 395 STIVGVGSPDPPQFVYDDDEYKDVFLSEANFITRPTNQWYTEPLSTDACTSPTGSSRSIE 216 STIVGVGSPDPP F+YD+DEYKDVFLSEA+FITR +QWYTEP S A TS SS+S+E Sbjct: 347 STIVGVGSPDPPHFLYDEDEYKDVFLSEASFITRSPDQWYTEPFSATASTSKMESSQSVE 406 >gb|EMJ13549.1| hypothetical protein PRUPE_ppa006793mg [Prunus persica] Length = 395 Score = 94.0 bits (232), Expect = 2e-17 Identities = 44/60 (73%), Positives = 49/60 (81%) Frame = -3 Query: 395 STIVGVGSPDPPQFVYDDDEYKDVFLSEANFITRPTNQWYTEPLSTDACTSPTGSSRSIE 216 STIVG+GSPDPPQFVYDDDEY+DVFLSEANF+TR N WYTEP S A S + S+SIE Sbjct: 336 STIVGIGSPDPPQFVYDDDEYRDVFLSEANFLTREENNWYTEPASRSARGSSSQFSQSIE 395 >ref|XP_002267319.2| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic/chromoplastic-like [Vitis vinifera] gi|296083918|emb|CBI24306.3| unnamed protein product [Vitis vinifera] Length = 394 Score = 94.0 bits (232), Expect = 2e-17 Identities = 43/56 (76%), Positives = 48/56 (85%), Gaps = 1/56 (1%) Frame = -3 Query: 395 STIVGVGSPDPPQFVYDDDEYKDVFLSEANFITRPTNQWYTEPLSTDAC-TSPTGS 231 STIVG+GSPDPPQF+YDDDEY+DVFLSEA+FITR NQWYT+P ST AC SP S Sbjct: 337 STIVGIGSPDPPQFIYDDDEYQDVFLSEASFITRAANQWYTQPASTGACYNSPNQS 392 >ref|XP_006446412.1| hypothetical protein CICLE_v10015579mg [Citrus clementina] gi|557549023|gb|ESR59652.1| hypothetical protein CICLE_v10015579mg [Citrus clementina] Length = 384 Score = 92.8 bits (229), Expect = 4e-17 Identities = 40/59 (67%), Positives = 48/59 (81%) Frame = -3 Query: 395 STIVGVGSPDPPQFVYDDDEYKDVFLSEANFITRPTNQWYTEPLSTDACTSPTGSSRSI 219 STIVG+GSPDPPQF+YDD+EY+DVFLSEA FITR NQWY E ST+AC+ P S ++ Sbjct: 325 STIVGIGSPDPPQFIYDDNEYEDVFLSEARFITREVNQWYRESASTNACSEPPAFSETV 383 >gb|EXB54665.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [Morus notabilis] Length = 455 Score = 92.4 bits (228), Expect = 5e-17 Identities = 44/65 (67%), Positives = 49/65 (75%), Gaps = 5/65 (7%) Frame = -3 Query: 395 STIVGVGSPDPPQFVYDDDEYKDVFLSEANFITRPTNQWYTEPLSTDACTSPTGS----- 231 STIVG+GSPDPPQF+YDD+EYKDVFLSEANF+TR NQWY EP S A SP Sbjct: 335 STIVGIGSPDPPQFIYDDEEYKDVFLSEANFLTREANQWYKEPASASATCSPPNDFSHDF 394 Query: 230 SRSIE 216 S+SIE Sbjct: 395 SQSIE 399 >ref|XP_002298150.2| hypothetical protein POPTR_0001s23230g [Populus trichocarpa] gi|550347970|gb|EEE82955.2| hypothetical protein POPTR_0001s23230g [Populus trichocarpa] Length = 390 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/60 (66%), Positives = 49/60 (81%) Frame = -3 Query: 395 STIVGVGSPDPPQFVYDDDEYKDVFLSEANFITRPTNQWYTEPLSTDACTSPTGSSRSIE 216 STIVG+GSPDPPQF+YD+DEY+DVF+SEANF+ R NQWY +P ST C+SP SR +E Sbjct: 332 STIVGIGSPDPPQFIYDEDEYQDVFVSEANFLAREANQWYQQPAST-TCSSPPEFSRPVE 390 >gb|ABP96842.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [Salvia miltiorrhiza] Length = 396 Score = 90.9 bits (224), Expect = 2e-16 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = -3 Query: 395 STIVGVGSPDPPQFVYDDDEYKDVFLSEANFITRPTNQWYTEPLSTDACT 246 STIVGVGSPDPPQFVYDDDEYK+VFLS+A FITR +QWY+EPLSTD T Sbjct: 343 STIVGVGSPDPPQFVYDDDEYKNVFLSDAKFITRSAHQWYSEPLSTDEST 392 >gb|AAG01340.1|AF288615_1 4-diphosphocytidyl-2C-methyl-D-erythritol kinase [Arabidopsis thaliana] Length = 383 Score = 90.5 bits (223), Expect = 2e-16 Identities = 39/55 (70%), Positives = 46/55 (83%) Frame = -3 Query: 395 STIVGVGSPDPPQFVYDDDEYKDVFLSEANFITRPTNQWYTEPLSTDACTSPTGS 231 STI+G+GSPDPPQF+YDD+EYKDVFLSEANF+TR N+WY EP S +A TS S Sbjct: 324 STIIGIGSPDPPQFIYDDEEYKDVFLSEANFMTREANEWYKEPASANATTSSAES 378 >gb|ABI35992.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [Catharanthus roseus] Length = 408 Score = 90.5 bits (223), Expect = 2e-16 Identities = 44/61 (72%), Positives = 51/61 (83%), Gaps = 1/61 (1%) Frame = -3 Query: 395 STIVGVGSPDPPQFVYDDDEYKDVFLSEANFITRPTNQWYTEP-LSTDACTSPTGSSRSI 219 STIVGVGSPDPPQF+YDD+EYKDV LSEA+F+TRP NQWY+EP LST +S T S+S Sbjct: 348 STIVGVGSPDPPQFIYDDEEYKDVSLSEASFLTRPPNQWYSEPGLSTACSSSGTDFSQSS 407 Query: 218 E 216 E Sbjct: 408 E 408 >ref|XP_006362734.1| PREDICTED: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic/chromoplastic-like [Solanum tuberosum] Length = 408 Score = 89.7 bits (221), Expect = 4e-16 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 395 STIVGVGSPDPPQFVYDDDEYKDVFLSEANFITRPTNQWYTEPLS 261 STIVGVGSPDPPQFVYDD+EYKDVFLSEA+FITRP N+WY EP+S Sbjct: 339 STIVGVGSPDPPQFVYDDEEYKDVFLSEASFITRPANEWYVEPVS 383 >ref|XP_004228879.1| PREDICTED: LOW QUALITY PROTEIN: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic/chromoplastic [Solanum lycopersicum] Length = 410 Score = 89.7 bits (221), Expect = 4e-16 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 395 STIVGVGSPDPPQFVYDDDEYKDVFLSEANFITRPTNQWYTEPLS 261 STIVGVGSPDPPQFVYDD+EYKDVFLSEA+FITRP N+WY EP+S Sbjct: 349 STIVGVGSPDPPQFVYDDEEYKDVFLSEASFITRPANEWYVEPVS 393 >gb|AAF76143.1|AF258339_1 4-diphosphocytidyl-2C-methyl-D-erythritol kinase [Expression vector pNCO-HIS6-TM-YCHB] Length = 331 Score = 89.7 bits (221), Expect = 4e-16 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 395 STIVGVGSPDPPQFVYDDDEYKDVFLSEANFITRPTNQWYTEPLS 261 STIVGVGSPDPPQFVYDD+EYKDVFLSEA+FITRP N+WY EP+S Sbjct: 270 STIVGVGSPDPPQFVYDDEEYKDVFLSEASFITRPANEWYVEPVS 314 >sp|P93841.1|ISPE_SOLLC RecName: Full=4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic/chromoplastic; AltName: Full=4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase; Short=CMK; AltName: Full=Ripening-associated protein pTOM41; Flags: Precursor gi|9454221|gb|AAF87717.1|AF263101_1 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [Solanum lycopersicum] gi|1899050|gb|AAB49936.1| ripening-associated protein, partial [Solanum lycopersicum] Length = 401 Score = 89.7 bits (221), Expect = 4e-16 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -3 Query: 395 STIVGVGSPDPPQFVYDDDEYKDVFLSEANFITRPTNQWYTEPLS 261 STIVGVGSPDPPQFVYDD+EYKDVFLSEA+FITRP N+WY EP+S Sbjct: 340 STIVGVGSPDPPQFVYDDEEYKDVFLSEASFITRPANEWYVEPVS 384 >ref|XP_006294319.1| hypothetical protein CARUB_v10023327mg, partial [Capsella rubella] gi|482563027|gb|EOA27217.1| hypothetical protein CARUB_v10023327mg, partial [Capsella rubella] Length = 408 Score = 89.4 bits (220), Expect = 5e-16 Identities = 39/55 (70%), Positives = 47/55 (85%) Frame = -3 Query: 395 STIVGVGSPDPPQFVYDDDEYKDVFLSEANFITRPTNQWYTEPLSTDACTSPTGS 231 STIVG+GSPDPPQF+YDD+EYK+VFLSEANF+TR N+WY EP S +A TS + S Sbjct: 349 STIVGIGSPDPPQFIYDDEEYKNVFLSEANFMTREANEWYKEPASANATTSSSES 403 >ref|NP_180261.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [Arabidopsis thaliana] gi|7387807|sp|O81014.1|ISPE_ARATH RecName: Full=4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic; AltName: Full=4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase; Short=CDPMEK; Short=CMEK; AltName: Full=Protein PIGMENT DEFECTIVE 277; Flags: Precursor gi|3426035|gb|AAC32234.1| putative ripening-associated protein [Arabidopsis thaliana] gi|12697585|dbj|BAB21593.1| 4-(cytidine 5'-phospho)-2-C-methyl-D-erithritol kinase [Arabidopsis thaliana] gi|22531112|gb|AAM97060.1| putative ripening-associated protein [Arabidopsis thaliana] gi|23198000|gb|AAN15527.1| putative ripening-associated protein [Arabidopsis thaliana] gi|330252814|gb|AEC07908.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [Arabidopsis thaliana] Length = 383 Score = 88.6 bits (218), Expect = 8e-16 Identities = 38/55 (69%), Positives = 46/55 (83%) Frame = -3 Query: 395 STIVGVGSPDPPQFVYDDDEYKDVFLSEANFITRPTNQWYTEPLSTDACTSPTGS 231 STI+G+GSPDPPQF+YDD+EYK+VFLSEANF+TR N+WY EP S +A TS S Sbjct: 324 STIIGIGSPDPPQFIYDDEEYKNVFLSEANFMTREANEWYKEPASANATTSSAES 378 >sp|P56848.1|ISPE_MENPI RecName: Full=4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic; AltName: Full=4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase; Short=CMK; Flags: Precursor gi|6478464|gb|AAF13866.1|AF179283_1 isopentenyl monophosphate kinase [Mentha x piperita] gi|6688843|emb|CAB65292.1| isopentenyl monophosphate kinase [Mentha x piperita] Length = 405 Score = 88.6 bits (218), Expect = 8e-16 Identities = 40/51 (78%), Positives = 43/51 (84%) Frame = -3 Query: 395 STIVGVGSPDPPQFVYDDDEYKDVFLSEANFITRPTNQWYTEPLSTDACTS 243 STIVGVGSPDPPQFVYD DEYK++F SEA FITR NQWY+EPLSTD S Sbjct: 349 STIVGVGSPDPPQFVYDGDEYKNIFFSEAKFITRSANQWYSEPLSTDESPS 399 >gb|ABO87658.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [Nicotiana benthamiana] Length = 409 Score = 88.6 bits (218), Expect = 8e-16 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = -3 Query: 395 STIVGVGSPDPPQFVYDDDEYKDVFLSEANFITRPTNQWYTEPLS 261 STIVGVGSPDPPQFVYDD+EYKDVFLSEA+FITR NQWY EPLS Sbjct: 348 STIVGVGSPDPPQFVYDDEEYKDVFLSEASFITRAANQWYEEPLS 392