BLASTX nr result
ID: Rehmannia23_contig00020871
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00020871 (568 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004230019.1| PREDICTED: CDPK-related kinase 3-like [Solan... 55 7e-07 gb|EOX95616.1| CDPK-related kinase 3 isoform 1 [Theobroma cacao] 48 9e-07 ref|XP_006444766.1| hypothetical protein CICLE_v10019386mg [Citr... 46 4e-06 ref|XP_006339759.1| PREDICTED: CDPK-related kinase 3-like isofor... 52 6e-06 ref|XP_002529963.1| calcium-dependent protein kinase, putative [... 48 1e-05 >ref|XP_004230019.1| PREDICTED: CDPK-related kinase 3-like [Solanum lycopersicum] Length = 589 Score = 55.1 bits (131), Expect(2) = 7e-07 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -3 Query: 566 ELARELNVGPTIHHMLRDWLTSNGRLSLLGYTIF 465 ELARELNVGPT H +LRDW+ ++G+L++LGYT F Sbjct: 542 ELARELNVGPTAHSILRDWIRNDGKLNMLGYTKF 575 Score = 23.9 bits (50), Expect(2) = 7e-07 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -2 Query: 468 FSHGLTLRSSNMRHH 424 F HG+TLRS+ +R H Sbjct: 575 FLHGVTLRSTPVRRH 589 >gb|EOX95616.1| CDPK-related kinase 3 isoform 1 [Theobroma cacao] Length = 630 Score = 48.1 bits (113), Expect(2) = 9e-07 Identities = 23/35 (65%), Positives = 29/35 (82%), Gaps = 1/35 (2%) Frame = -3 Query: 566 ELARELNVGPTIHHMLRDWL-TSNGRLSLLGYTIF 465 ELARELNVGP+ + L+DW+ S+G+LSLLGYT F Sbjct: 582 ELARELNVGPSAYSFLKDWIRISDGKLSLLGYTKF 616 Score = 30.4 bits (67), Expect(2) = 9e-07 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -2 Query: 468 FSHGLTLRSSNMRHH 424 F HG+TLRSSN RHH Sbjct: 616 FLHGVTLRSSNTRHH 630 >ref|XP_006444766.1| hypothetical protein CICLE_v10019386mg [Citrus clementina] gi|568876557|ref|XP_006491344.1| PREDICTED: CDPK-related kinase 3-like [Citrus sinensis] gi|557547028|gb|ESR58006.1| hypothetical protein CICLE_v10019386mg [Citrus clementina] Length = 601 Score = 45.8 bits (107), Expect(2) = 4e-06 Identities = 22/35 (62%), Positives = 28/35 (80%), Gaps = 1/35 (2%) Frame = -3 Query: 566 ELARELNVGPTIHHMLRDWL-TSNGRLSLLGYTIF 465 ELARELNVGP+ + L+DW+ S+G+LSL GYT F Sbjct: 553 ELARELNVGPSAYSFLKDWIRNSDGKLSLHGYTKF 587 Score = 30.4 bits (67), Expect(2) = 4e-06 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -2 Query: 468 FSHGLTLRSSNMRHH 424 F HG+TLRSSN RHH Sbjct: 587 FLHGVTLRSSNTRHH 601 >ref|XP_006339759.1| PREDICTED: CDPK-related kinase 3-like isoform X1 [Solanum tuberosum] gi|565345351|ref|XP_006339760.1| PREDICTED: CDPK-related kinase 3-like isoform X2 [Solanum tuberosum] Length = 589 Score = 52.0 bits (123), Expect(2) = 6e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = -3 Query: 566 ELARELNVGPTIHHMLRDWLTSNGRLSLLGYTIF 465 ELARELNVG T H +LRDW+ ++G+L++LGYT F Sbjct: 542 ELARELNVGQTAHSILRDWMRNDGKLNMLGYTKF 575 Score = 23.9 bits (50), Expect(2) = 6e-06 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -2 Query: 468 FSHGLTLRSSNMRHH 424 F HG+TLRS+ +R H Sbjct: 575 FLHGVTLRSTPVRRH 589 >ref|XP_002529963.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223530525|gb|EEF32406.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 602 Score = 47.8 bits (112), Expect(2) = 1e-05 Identities = 22/35 (62%), Positives = 29/35 (82%), Gaps = 1/35 (2%) Frame = -3 Query: 566 ELARELNVGPTIHHMLRDWL-TSNGRLSLLGYTIF 465 ELARELNVGP+ + ++DW+ S+G+LSLLGYT F Sbjct: 554 ELARELNVGPSAYSFIKDWIRNSDGKLSLLGYTKF 588 Score = 27.3 bits (59), Expect(2) = 1e-05 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -2 Query: 468 FSHGLTLRSSNMRH 427 F HG+TLRSSN RH Sbjct: 588 FLHGVTLRSSNTRH 601