BLASTX nr result
ID: Rehmannia23_contig00020646
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00020646 (482 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006347421.1| PREDICTED: BTB/POZ and TAZ domain-containing... 70 2e-10 ref|XP_004241527.1| PREDICTED: BTB/POZ and TAZ domain-containing... 70 2e-10 emb|CBI14900.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_002278192.1| PREDICTED: BTB/POZ and TAZ domain-containing... 67 2e-09 ref|XP_003549831.2| PREDICTED: BTB/POZ and TAZ domain-containing... 62 1e-07 ref|XP_006351442.1| PREDICTED: BTB/POZ and TAZ domain-containing... 61 1e-07 gb|EOY22321.1| BTB and TAZ domain protein 2 isoform 3, partial [... 61 2e-07 gb|EOY22320.1| BTB and TAZ domain protein 2 isoform 2 [Theobroma... 61 2e-07 gb|EOY22319.1| BTB and TAZ domain protein 2 isoform 1 [Theobroma... 61 2e-07 ref|XP_004236301.1| PREDICTED: BTB/POZ and TAZ domain-containing... 60 2e-07 ref|XP_006580649.1| PREDICTED: BTB/POZ and TAZ domain-containing... 59 7e-07 gb|ACU23356.1| unknown [Glycine max] 57 2e-06 ref|XP_002322214.2| speckle-type POZ family protein [Populus tri... 57 3e-06 ref|XP_004515848.1| PREDICTED: BTB/POZ and TAZ domain-containing... 57 3e-06 ref|XP_002511276.1| protein binding protein, putative [Ricinus c... 56 4e-06 ref|XP_006347420.1| PREDICTED: BTB/POZ and TAZ domain-containing... 55 1e-05 >ref|XP_006347421.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum tuberosum] Length = 349 Score = 70.5 bits (171), Expect = 2e-10 Identities = 36/60 (60%), Positives = 48/60 (80%), Gaps = 2/60 (3%) Frame = -2 Query: 481 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFKL 308 R+FKLKV +Q+G D LW+ LVRKV SA+A+ LSLPKRKREEEP+MD+ H ++ +F+L Sbjct: 291 RQFKLKV---QQKGDDELWKSLVRKVVSARAMSSLSLPKRKREEEPKMDLSHPQVMNFRL 347 >ref|XP_004241527.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 2-like [Solanum lycopersicum] Length = 349 Score = 70.5 bits (171), Expect = 2e-10 Identities = 36/60 (60%), Positives = 48/60 (80%), Gaps = 2/60 (3%) Frame = -2 Query: 481 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFKL 308 R+FKLKV +Q+G D LW+ LVRKV SA+A+ LSLPKRKREEEP+MD +H ++ +F+L Sbjct: 291 RQFKLKV---QQKGDDELWKSLVRKVVSARAMSSLSLPKRKREEEPKMDFNHHQVMNFRL 347 >emb|CBI14900.3| unnamed protein product [Vitis vinifera] Length = 347 Score = 67.4 bits (163), Expect = 2e-09 Identities = 37/61 (60%), Positives = 47/61 (77%), Gaps = 3/61 (4%) Frame = -2 Query: 481 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQE-MSSFK 311 R+FKLK Q+ ++G D W+LLVRKV SAKA+ LSLPKRKREEEPR +DH+ + SF+ Sbjct: 288 RQFKLKA-QQVKKGEDARWKLLVRKVVSAKAMSSLSLPKRKREEEPRQTLDHRHGLGSFR 346 Query: 310 L 308 L Sbjct: 347 L 347 >ref|XP_002278192.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Vitis vinifera] Length = 351 Score = 67.4 bits (163), Expect = 2e-09 Identities = 37/61 (60%), Positives = 47/61 (77%), Gaps = 3/61 (4%) Frame = -2 Query: 481 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQE-MSSFK 311 R+FKLK Q+ ++G D W+LLVRKV SAKA+ LSLPKRKREEEPR +DH+ + SF+ Sbjct: 292 RQFKLKA-QQVKKGEDARWKLLVRKVVSAKAMSSLSLPKRKREEEPRQTLDHRHGLGSFR 350 Query: 310 L 308 L Sbjct: 351 L 351 >ref|XP_003549831.2| PREDICTED: BTB/POZ and TAZ domain-containing protein 1 [Glycine max] Length = 396 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/60 (55%), Positives = 46/60 (76%), Gaps = 2/60 (3%) Frame = -2 Query: 481 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFKL 308 R+F+L++ QE+++ D W+LL RKVASAK + LSLPKRKR+EE R+ MD+ + SFKL Sbjct: 337 RQFQLRMQQEKRK-DDAKWKLLARKVASAKVMSSLSLPKRKRDEETRVTMDNPGIRSFKL 395 >ref|XP_006351442.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum tuberosum] Length = 345 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/58 (55%), Positives = 44/58 (75%), Gaps = 2/58 (3%) Frame = -2 Query: 481 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSF 314 R+FK KV +++G D LW+ LV KV SA+A+ LSLPKRKREEEP+M++ H ++ SF Sbjct: 285 RQFKEKV---QRKGDDGLWKSLVEKVVSARALSSLSLPKRKREEEPKMNLHHHQVRSF 339 >gb|EOY22321.1| BTB and TAZ domain protein 2 isoform 3, partial [Theobroma cacao] Length = 253 Score = 60.8 bits (146), Expect = 2e-07 Identities = 35/59 (59%), Positives = 41/59 (69%), Gaps = 2/59 (3%) Frame = -2 Query: 481 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFK 311 R+FKLK Q+R G D LW+LLVRKV SAK I LSLPKRKREEE R M + +F+ Sbjct: 194 RQFKLKAQQQRM-GDDALWKLLVRKVLSAKTISSLSLPKRKREEELRETMGGHALRTFR 251 >gb|EOY22320.1| BTB and TAZ domain protein 2 isoform 2 [Theobroma cacao] Length = 334 Score = 60.8 bits (146), Expect = 2e-07 Identities = 35/59 (59%), Positives = 41/59 (69%), Gaps = 2/59 (3%) Frame = -2 Query: 481 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFK 311 R+FKLK Q+R G D LW+LLVRKV SAK I LSLPKRKREEE R M + +F+ Sbjct: 275 RQFKLKAQQQRM-GDDALWKLLVRKVLSAKTISSLSLPKRKREEELRETMGGHALRTFR 332 >gb|EOY22319.1| BTB and TAZ domain protein 2 isoform 1 [Theobroma cacao] Length = 354 Score = 60.8 bits (146), Expect = 2e-07 Identities = 35/59 (59%), Positives = 41/59 (69%), Gaps = 2/59 (3%) Frame = -2 Query: 481 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFK 311 R+FKLK Q+R G D LW+LLVRKV SAK I LSLPKRKREEE R M + +F+ Sbjct: 295 RQFKLKAQQQRM-GDDALWKLLVRKVLSAKTISSLSLPKRKREEELRETMGGHALRTFR 352 >ref|XP_004236301.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum lycopersicum] Length = 345 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/58 (53%), Positives = 44/58 (75%), Gaps = 2/58 (3%) Frame = -2 Query: 481 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSF 314 R+FK KV +++G D +W+ LV KV SA+A+ LSLPKRKREEEP+M++ H ++ SF Sbjct: 285 RQFKEKV---QRKGDDGVWKSLVEKVVSARALSSLSLPKRKREEEPKMNLQHHQVRSF 339 >ref|XP_006580649.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Glycine max] Length = 310 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/60 (51%), Positives = 47/60 (78%), Gaps = 2/60 (3%) Frame = -2 Query: 481 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFKL 308 R+F+L++ QE+++ D W+LL RKVASAK + LSLPKRKR+EE R+++++ + SFKL Sbjct: 251 RQFQLRMQQEKRK-DDAKWKLLARKVASAKVMSSLSLPKRKRDEETRVNINNPGIRSFKL 309 >gb|ACU23356.1| unknown [Glycine max] Length = 351 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/60 (50%), Positives = 46/60 (76%), Gaps = 2/60 (3%) Frame = -2 Query: 481 REFKLKVVQERQRGSDLLWRLLVRKVASAKAILS--LPKRKREEEPRMDMDHQEMSSFKL 308 R+F+L++ QE+++ D W+LL RKVASAK + S LPKRKR+EE R+++++ + SFKL Sbjct: 292 RQFQLRMQQEKRK-DDAKWKLLARKVASAKVMFSLFLPKRKRDEETRVNINNPGIRSFKL 350 >ref|XP_002322214.2| speckle-type POZ family protein [Populus trichocarpa] gi|550322402|gb|EEF06341.2| speckle-type POZ family protein [Populus trichocarpa] Length = 360 Score = 56.6 bits (135), Expect = 3e-06 Identities = 34/60 (56%), Positives = 45/60 (75%), Gaps = 2/60 (3%) Frame = -2 Query: 481 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFKL 308 R+FKLK+ E+ +G + LWRLLV+KVASA+A+ LSLPKRKR EEPR M + +F+L Sbjct: 303 RQFKLKMQLEK-KGVETLWRLLVKKVASARAMSSLSLPKRKR-EEPRETMHDHGIRNFRL 360 >ref|XP_004515848.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 2-like [Cicer arietinum] Length = 363 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/58 (53%), Positives = 44/58 (75%), Gaps = 2/58 (3%) Frame = -2 Query: 481 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSF 314 R+F+LK+ QE+++ D W+LL RKVASAK + LSLPKRKR+EE R+ +D+Q + F Sbjct: 290 RQFQLKMEQEKRK-DDPKWKLLARKVASAKVMFSLSLPKRKRDEEMRVAIDNQGIRCF 346 >ref|XP_002511276.1| protein binding protein, putative [Ricinus communis] gi|223550391|gb|EEF51878.1| protein binding protein, putative [Ricinus communis] Length = 363 Score = 56.2 bits (134), Expect = 4e-06 Identities = 30/60 (50%), Positives = 43/60 (71%), Gaps = 2/60 (3%) Frame = -2 Query: 481 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKREEEPRMDMDHQEMSSFKL 308 R+FKLK+ Q ++G D LW+LLVRKV SA+ + LSLPKRKREE+ + + + +F+L Sbjct: 305 RQFKLKM-QHEKKGDDALWKLLVRKVVSARVLSSLSLPKRKREEQLKETIHDHGIRTFRL 363 >ref|XP_006347420.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Solanum tuberosum] Length = 349 Score = 55.1 bits (131), Expect = 1e-05 Identities = 34/55 (61%), Positives = 42/55 (76%), Gaps = 4/55 (7%) Frame = -2 Query: 481 REFKLKVVQERQRGSDLLWRLLVRKVASAKAI--LSLPKRKR-EEEPRMDM-DHQ 329 REFK K+ +RG D LW+ LVRKV SA+A+ LSLPKRKR EEEPR+++ DHQ Sbjct: 292 REFKQKL---EKRGDDELWKSLVRKVVSARAMTFLSLPKRKREEEEPRLNLRDHQ 343