BLASTX nr result
ID: Rehmannia23_contig00020539
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00020539 (357 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB84221.1| Dipeptidyl peptidase 8 [Morus notabilis] 64 2e-08 ref|XP_004307986.1| PREDICTED: dipeptidyl peptidase 8-like [Frag... 59 5e-07 gb|EMJ21446.1| hypothetical protein PRUPE_ppa001695mg [Prunus pe... 59 9e-07 ref|XP_004234962.1| PREDICTED: dipeptidyl peptidase 8-like [Sola... 55 7e-06 ref|XP_006350553.1| PREDICTED: dipeptidyl peptidase 8-like [Sola... 55 1e-05 >gb|EXB84221.1| Dipeptidyl peptidase 8 [Morus notabilis] Length = 881 Score = 64.3 bits (155), Expect = 2e-08 Identities = 34/55 (61%), Positives = 41/55 (74%), Gaps = 2/55 (3%) Frame = +3 Query: 198 FVMQS--PNKSNKQNLKRLRSLLHEMPENNTDANVLDNCTTFPIEEIVQYPLPGY 356 FVMQ+ +KS K+NLKR RS MP TD+N+LD+C FP+EEIVQYPLPGY Sbjct: 69 FVMQAFDDDKSKKKNLKRSRSSPCNMPV--TDSNILDDCILFPVEEIVQYPLPGY 121 >ref|XP_004307986.1| PREDICTED: dipeptidyl peptidase 8-like [Fragaria vesca subsp. vesca] Length = 775 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/54 (55%), Positives = 38/54 (70%), Gaps = 3/54 (5%) Frame = +3 Query: 204 MQSPNKSNKQNLKRLRSLLHEMPENNTDANV---LDNCTTFPIEEIVQYPLPGY 356 MQS +++ + NLKR RS EMP TD N+ LD+C FP+EEIVQ+PLPGY Sbjct: 1 MQSVHENKRNNLKRSRSFTREMPV--TDCNISQKLDDCIVFPVEEIVQHPLPGY 52 >gb|EMJ21446.1| hypothetical protein PRUPE_ppa001695mg [Prunus persica] Length = 778 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/54 (55%), Positives = 41/54 (75%), Gaps = 3/54 (5%) Frame = +3 Query: 204 MQSPNKSN--KQNLKRLRSLLHEMPENNTD-ANVLDNCTTFPIEEIVQYPLPGY 356 MQS ++ N K+NLKR RS ++MP +++ A+ LD+C FP+EEIVQYPLPGY Sbjct: 1 MQSVDEENNKKKNLKRSRSSSYDMPVTDSNFAHSLDDCVLFPVEEIVQYPLPGY 54 >ref|XP_004234962.1| PREDICTED: dipeptidyl peptidase 8-like [Solanum lycopersicum] Length = 774 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/51 (54%), Positives = 35/51 (68%), Gaps = 1/51 (1%) Frame = +3 Query: 204 MQSPNKSNKQNLKRLRSLLHEMPENNTD-ANVLDNCTTFPIEEIVQYPLPG 353 MQS N K+ LKR RS EMP +T+ A L++C FP+E+IVQYPLPG Sbjct: 1 MQSINSGEKKCLKRSRSFSSEMPGTDTNVAKPLEDCVLFPVEDIVQYPLPG 51 >ref|XP_006350553.1| PREDICTED: dipeptidyl peptidase 8-like [Solanum tuberosum] Length = 774 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/51 (54%), Positives = 35/51 (68%), Gaps = 1/51 (1%) Frame = +3 Query: 204 MQSPNKSNKQNLKRLRSLLHEMPENNTD-ANVLDNCTTFPIEEIVQYPLPG 353 MQS N K+ LKR RS EMP +T+ A L++C FP+E+IVQYPLPG Sbjct: 1 MQSINSGEKKCLKRSRSFSSEMPGTDTNVAKPLEDCILFPVEDIVQYPLPG 51