BLASTX nr result
ID: Rehmannia23_contig00020327
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00020327 (1298 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006855103.1| hypothetical protein AMTR_s00031p00183990 [A... 59 6e-06 >ref|XP_006855103.1| hypothetical protein AMTR_s00031p00183990 [Amborella trichopoda] gi|548858832|gb|ERN16570.1| hypothetical protein AMTR_s00031p00183990 [Amborella trichopoda] Length = 237 Score = 58.5 bits (140), Expect = 6e-06 Identities = 30/48 (62%), Positives = 36/48 (75%), Gaps = 3/48 (6%) Frame = -1 Query: 521 LQYCMNHPEDTNKVSNLKAQIMNVKAIMIDNMEKVC---FRIILFLDK 387 +QYCMNHPE+ +K+S LKAQI VK IMIDN+EKV RI L +DK Sbjct: 136 MQYCMNHPEEMSKLSKLKAQITEVKGIMIDNIEKVLDRGERIELLVDK 183