BLASTX nr result
ID: Rehmannia23_contig00019858
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00019858 (599 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74396.1| hypothetical protein M569_00359, partial [Genlise... 86 6e-20 ref|XP_004516902.1| PREDICTED: uncharacterized protein LOC101497... 63 2e-10 ref|YP_008815228.1| ribosomal protein S12 (chloroplast) [Kalopan... 71 3e-10 ref|YP_008815183.1| ribosomal protein S12 (chloroplast) [Kalopan... 71 3e-10 ref|YP_008815054.1| ribosomal protein S12 (chloroplast) [Metapan... 71 3e-10 ref|YP_008815009.1| ribosomal protein S12 (chloroplast) [Metapan... 71 3e-10 ref|YP_008814967.1| ribosomal protein S12 (chloroplast) [Brassai... 71 3e-10 ref|YP_008814922.1| ribosomal protein S12 (chloroplast) [Brassai... 71 3e-10 gb|AGZ19166.1| ribosomal protein S12 (chloroplast) [Camellia sin... 68 2e-09 ref|YP_008816226.1| ribosomal protein S12 (chloroplast) [Glycine... 64 2e-08 ref|XP_004516896.1| PREDICTED: 30S ribosomal protein S12, chloro... 64 2e-08 gb|AEQ36962.1| ribosomal protein S12 (chloroplast) [Datura stram... 64 2e-08 ref|YP_004940490.1| rps12 gene product (chloroplast) [Boea hygro... 64 2e-08 ref|YP_001381684.1| ribosomal protein S12 [Medicago truncatula] 64 2e-08 ref|YP_008592664.1| ribosomal protein S12 (chloroplast) [Berberi... 64 4e-08 gb|ABX26257.1| ribosomal protein S12-like protein [Panax quinque... 63 5e-08 gb|AFK38361.1| unknown [Medicago truncatula] 62 1e-07 gb|ESW29688.1| hypothetical protein PHAVU_002G090400g [Phaseolus... 60 6e-07 ref|XP_003605595.1| 30S ribosomal protein S12 [Medicago truncatu... 59 8e-07 emb|CCQ71644.1| ribosomal protein S12 (chloroplast) [Salvia milt... 59 1e-06 >gb|EPS74396.1| hypothetical protein M569_00359, partial [Genlisea aurea] Length = 106 Score = 86.3 bits (212), Expect(3) = 6e-20 Identities = 39/43 (90%), Positives = 40/43 (93%) Frame = +2 Query: 470 KAGFLLFFVSAHDLNESHIHPSTCSSTLRTSPKRGGFRDISNW 598 K G L+FFVSAHDLNESHIHPSTCSSTLRTSPK GGFRDISNW Sbjct: 46 KPGLLVFFVSAHDLNESHIHPSTCSSTLRTSPKGGGFRDISNW 88 Score = 28.9 bits (63), Expect(3) = 6e-20 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +1 Query: 340 IGFAPMETINFIHNRGTNLIIF 405 IGFAPM+TI FIH +++F Sbjct: 1 IGFAPMKTIRFIHISSYLVLVF 22 Score = 28.5 bits (62), Expect(3) = 6e-20 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +3 Query: 399 YF*IVNGIPSSILSYSMVLIIQTGK 473 +F IVNG+ SS L YS+ II +GK Sbjct: 22 FFLIVNGVRSSCLCYSLRHIIPSGK 46 >ref|XP_004516902.1| PREDICTED: uncharacterized protein LOC101497522 [Cicer arietinum] Length = 87 Score = 63.2 bits (152), Expect(2) = 2e-10 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -3 Query: 222 NGLRGSATQLTFIIKYRYCIGGSHCERPVTG*FMGRAKEC 103 NGLRGS TQL FI+KYRYCI CERP+T FMGRA +C Sbjct: 37 NGLRGSTTQLIFILKYRYCIARFRCERPITRYFMGRAHKC 76 Score = 28.1 bits (61), Expect(2) = 2e-10 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 316 NSPLVANGYPLSGENLI 266 N PLV N YPLSG+N I Sbjct: 8 NFPLVTNSYPLSGKNPI 24 >ref|YP_008815228.1| ribosomal protein S12 (chloroplast) [Kalopanax septemlobus] gi|458599672|gb|AGG39364.1| ribosomal protein S12 (chloroplast) [Kalopanax septemlobus] Length = 142 Score = 70.9 bits (172), Expect = 3e-10 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -2 Query: 598 PIRNVTKSPALRGCPQRRGTCTRVYVRLV*IMS*HKKKQ 482 PIRNVTKSPALRGCPQRRGTCTRVYVRLV IMS K+K+ Sbjct: 14 PIRNVTKSPALRGCPQRRGTCTRVYVRLVQIMSWDKRKK 52 >ref|YP_008815183.1| ribosomal protein S12 (chloroplast) [Kalopanax septemlobus] gi|458599659|gb|AGG39351.1| ribosomal protein S12 (chloroplast) [Kalopanax septemlobus] Length = 143 Score = 70.9 bits (172), Expect = 3e-10 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -2 Query: 598 PIRNVTKSPALRGCPQRRGTCTRVYVRLV*IMS*HKKKQ 482 PIRNVTKSPALRGCPQRRGTCTRVYVRLV IMS K+K+ Sbjct: 14 PIRNVTKSPALRGCPQRRGTCTRVYVRLVQIMSWDKRKK 52 >ref|YP_008815054.1| ribosomal protein S12 (chloroplast) [Metapanax delavayi] gi|458599431|gb|AGG39190.1| ribosomal protein S12 (chloroplast) [Metapanax delavayi] Length = 161 Score = 70.9 bits (172), Expect = 3e-10 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -2 Query: 598 PIRNVTKSPALRGCPQRRGTCTRVYVRLV*IMS*HKKKQ 482 PIRNVTKSPALRGCPQRRGTCTRVYVRLV IMS K+K+ Sbjct: 14 PIRNVTKSPALRGCPQRRGTCTRVYVRLVQIMSWDKRKK 52 >ref|YP_008815009.1| ribosomal protein S12 (chloroplast) [Metapanax delavayi] gi|458599418|gb|AGG39177.1| ribosomal protein S12 (chloroplast) [Metapanax delavayi] Length = 165 Score = 70.9 bits (172), Expect = 3e-10 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -2 Query: 598 PIRNVTKSPALRGCPQRRGTCTRVYVRLV*IMS*HKKKQ 482 PIRNVTKSPALRGCPQRRGTCTRVYVRLV IMS K+K+ Sbjct: 14 PIRNVTKSPALRGCPQRRGTCTRVYVRLVQIMSWDKRKK 52 >ref|YP_008814967.1| ribosomal protein S12 (chloroplast) [Brassaiopsis hainla] gi|558603148|ref|YP_008815141.1| ribosomal protein S12 (chloroplast) [Schefflera delavayi] gi|563940339|ref|YP_008814880.1| ribosomal protein S12 (chloroplast) [Aralia undulata] gi|458599150|gb|AGG39016.1| ribosomal protein S12 (chloroplast) [Aralia undulata] gi|458599252|gb|AGG39103.1| ribosomal protein S12 (chloroplast) [Brassaiopsis hainla] gi|458599584|gb|AGG39277.1| ribosomal protein S12 (chloroplast) [Schefflera delavayi] Length = 149 Score = 70.9 bits (172), Expect = 3e-10 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -2 Query: 598 PIRNVTKSPALRGCPQRRGTCTRVYVRLV*IMS*HKKKQ 482 PIRNVTKSPALRGCPQRRGTCTRVYVRLV IMS K+K+ Sbjct: 14 PIRNVTKSPALRGCPQRRGTCTRVYVRLVQIMSWDKRKK 52 >ref|YP_008814922.1| ribosomal protein S12 (chloroplast) [Brassaiopsis hainla] gi|558603135|ref|YP_008815096.1| ribosomal protein S12 (chloroplast) [Schefflera delavayi] gi|563940326|ref|YP_008814835.1| ribosomal protein S12 (chloroplast) [Aralia undulata] gi|458599137|gb|AGG39003.1| ribosomal protein S12 (chloroplast) [Aralia undulata] gi|458599239|gb|AGG39090.1| ribosomal protein S12 (chloroplast) [Brassaiopsis hainla] gi|458599571|gb|AGG39264.1| ribosomal protein S12 (chloroplast) [Schefflera delavayi] Length = 150 Score = 70.9 bits (172), Expect = 3e-10 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -2 Query: 598 PIRNVTKSPALRGCPQRRGTCTRVYVRLV*IMS*HKKKQ 482 PIRNVTKSPALRGCPQRRGTCTRVYVRLV IMS K+K+ Sbjct: 14 PIRNVTKSPALRGCPQRRGTCTRVYVRLVQIMSWDKRKK 52 >gb|AGZ19166.1| ribosomal protein S12 (chloroplast) [Camellia sinensis] Length = 60 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/43 (76%), Positives = 35/43 (81%) Frame = -2 Query: 598 PIRNVTKSPALRGCPQRRGTCTRVYVRLV*IMS*HKKKQETRF 470 PIRNVTKSPAL GCPQRRGTCTRVYVRLV IM K K+ +F Sbjct: 14 PIRNVTKSPALGGCPQRRGTCTRVYVRLVQIMGWDKTKERKQF 56 >ref|YP_008816226.1| ribosomal protein S12 (chloroplast) [Glycine soja] gi|558604199|ref|YP_008816270.1| ribosomal protein S12 (chloroplast) [Glycine soja] gi|557469752|gb|AHA04005.1| ribosomal protein S12 (chloroplast) [Glycine soja] gi|557469791|gb|AHA04044.1| ribosomal protein S12 (chloroplast) [Glycine soja] Length = 127 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -2 Query: 598 PIRNVTKSPALRGCPQRRGTCTRVYVRLV 512 PIRNVTKSPALRGCPQRRGTCTRVYVRLV Sbjct: 14 PIRNVTKSPALRGCPQRRGTCTRVYVRLV 42 >ref|XP_004516896.1| PREDICTED: 30S ribosomal protein S12, chloroplastic-like [Cicer arietinum] gi|502181875|ref|XP_004516900.1| PREDICTED: 30S ribosomal protein S12, chloroplastic-like [Cicer arietinum] Length = 42 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -2 Query: 598 PIRNVTKSPALRGCPQRRGTCTRVYVRLV 512 PIRNVTKSPALRGCPQRRGTCTRVYVRLV Sbjct: 14 PIRNVTKSPALRGCPQRRGTCTRVYVRLV 42 >gb|AEQ36962.1| ribosomal protein S12 (chloroplast) [Datura stramonium] Length = 122 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -2 Query: 598 PIRNVTKSPALRGCPQRRGTCTRVYVRLV 512 PIRNVTKSPALRGCPQRRGTCTRVYVRLV Sbjct: 14 PIRNVTKSPALRGCPQRRGTCTRVYVRLV 42 >ref|YP_004940490.1| rps12 gene product (chloroplast) [Boea hygrometrica] gi|340549431|gb|AEK53253.1| ribosomal protein S12 (chloroplast) [Boea hygrometrica] Length = 134 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -2 Query: 598 PIRNVTKSPALRGCPQRRGTCTRVYVRLV 512 PIRNVTKSPALRGCPQRRGTCTRVYVRLV Sbjct: 14 PIRNVTKSPALRGCPQRRGTCTRVYVRLV 42 >ref|YP_001381684.1| ribosomal protein S12 [Medicago truncatula] Length = 127 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -2 Query: 598 PIRNVTKSPALRGCPQRRGTCTRVYVRLV 512 PIRNVTKSPALRGCPQRRGTCTRVYVRLV Sbjct: 14 PIRNVTKSPALRGCPQRRGTCTRVYVRLV 42 >ref|YP_008592664.1| ribosomal protein S12 (chloroplast) [Berberis bealei] gi|536462705|gb|AGU37070.1| ribosomal protein S12 (chloroplast) [Berberis bealei] Length = 46 Score = 63.5 bits (153), Expect = 4e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -2 Query: 598 PIRNVTKSPALRGCPQRRGTCTRVYVRLV*IM 503 PI+NVTKSPALRGCPQRRGTCTRVYVRLV I+ Sbjct: 14 PIKNVTKSPALRGCPQRRGTCTRVYVRLVQII 45 >gb|ABX26257.1| ribosomal protein S12-like protein [Panax quinquefolius] Length = 65 Score = 63.2 bits (152), Expect = 5e-08 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -2 Query: 598 PIRNVTKSPALRGCPQRRGTCTRVYVRLV*IMS*HKKKQ 482 PIRNV KSPALRGCPQRRGTCTR YV LV IMS K+K+ Sbjct: 14 PIRNVPKSPALRGCPQRRGTCTRGYVGLVQIMSWDKRKK 52 >gb|AFK38361.1| unknown [Medicago truncatula] Length = 82 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -3 Query: 222 NGLRGSATQLTFIIKYRYCIGGSHCERPVTG*FMGRAKEC 103 NGLRGS TQL FI+KYRYCI CERP+T FMGRA +C Sbjct: 32 NGLRGSTTQLIFILKYRYCIARFCCERPITRYFMGRAHKC 71 >gb|ESW29688.1| hypothetical protein PHAVU_002G090400g [Phaseolus vulgaris] Length = 46 Score = 59.7 bits (143), Expect = 6e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 598 PIRNVTKSPALRGCPQRRGTCTRVYVRLV 512 PIRNVTKSPAL+GCPQRR TCTRVYVRLV Sbjct: 14 PIRNVTKSPALQGCPQRRETCTRVYVRLV 42 >ref|XP_003605595.1| 30S ribosomal protein S12 [Medicago truncatula] gi|355506650|gb|AES87792.1| 30S ribosomal protein S12 [Medicago truncatula] Length = 162 Score = 59.3 bits (142), Expect = 8e-07 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 598 PIRNVTKSPALRGCPQRRGTCTRVYV 521 PIRNVTKSPALRGCPQRRGTCTRVYV Sbjct: 14 PIRNVTKSPALRGCPQRRGTCTRVYV 39 >emb|CCQ71644.1| ribosomal protein S12 (chloroplast) [Salvia miltiorrhiza] Length = 122 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -2 Query: 598 PIRNVTKSPALRGCPQRRGTCTRVYV 521 PIRNVTKSPALRGCPQRRGTCTRVY+ Sbjct: 14 PIRNVTKSPALRGCPQRRGTCTRVYI 39