BLASTX nr result
ID: Rehmannia23_contig00019705
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00019705 (334 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS69032.1| hypothetical protein M569_05731, partial [Genlise... 59 5e-07 >gb|EPS69032.1| hypothetical protein M569_05731, partial [Genlisea aurea] Length = 851 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = -2 Query: 135 LISNDIVSTHAARVNAPAKSDSFTPPDNFLIDCGNSGSTTLPGNR 1 L+S + HAA +NAPAKSD+FTP DN L+DCGNS T PG R Sbjct: 10 LLSFATQTLHAALLNAPAKSDAFTPSDNILLDCGNSAGVTAPGGR 54