BLASTX nr result
ID: Rehmannia23_contig00018897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00018897 (415 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316747.1| predicted protein [Populus trichocarpa] 87 2e-15 gb|EMJ13198.1| hypothetical protein PRUPE_ppa011078mg [Prunus pe... 85 9e-15 gb|EOY27863.1| Pentatricopeptide repeat superfamily protein [The... 82 6e-14 ref|XP_006449586.1| hypothetical protein CICLE_v10016169mg [Citr... 82 1e-13 ref|XP_006355563.1| PREDICTED: pentatricopeptide repeat-containi... 80 3e-13 ref|XP_004232997.1| PREDICTED: pentatricopeptide repeat-containi... 80 3e-13 ref|XP_002269512.2| PREDICTED: pentatricopeptide repeat-containi... 80 3e-13 emb|CBI30774.3| unnamed protein product [Vitis vinifera] 80 3e-13 ref|XP_004294568.1| PREDICTED: pentatricopeptide repeat-containi... 79 6e-13 ref|NP_001031667.1| pentatricopeptide repeat-containing protein ... 79 6e-13 ref|NP_567571.1| pentatricopeptide repeat-containing protein [Ar... 79 6e-13 gb|AAT06467.1| At4g18975 [Arabidopsis thaliana] gi|62320588|dbj|... 79 6e-13 emb|CAA16754.1| putative protein [Arabidopsis thaliana] gi|72686... 79 6e-13 ref|XP_002867967.1| hypothetical protein ARALYDRAFT_914772 [Arab... 78 1e-12 gb|EXB58283.1| hypothetical protein L484_015617 [Morus notabilis] 77 3e-12 dbj|BAC83317.1| pentatricopeptide (PPR) repeat-containing protei... 77 3e-12 gb|EAZ04241.1| hypothetical protein OsI_26386 [Oryza sativa Indi... 76 4e-12 ref|XP_006658667.1| PREDICTED: pentatricopeptide repeat-containi... 75 7e-12 ref|XP_006467567.1| PREDICTED: pentatricopeptide repeat-containi... 75 7e-12 gb|ESW19954.1| hypothetical protein PHAVU_006G168700g [Phaseolus... 75 9e-12 >ref|XP_002316747.1| predicted protein [Populus trichocarpa] Length = 272 Score = 87.0 bits (214), Expect = 2e-15 Identities = 39/49 (79%), Positives = 45/49 (91%) Frame = -3 Query: 149 KLIQKPGKKEHHLWQKRDSAGSGQKAMDLVHTISRLPNEKEAVYGALDK 3 K+++K GKKEHHLWQKRDSAGSGQKA++LV +S LPNEKEAVYGALDK Sbjct: 58 KVVKKSGKKEHHLWQKRDSAGSGQKALNLVRIVSELPNEKEAVYGALDK 106 >gb|EMJ13198.1| hypothetical protein PRUPE_ppa011078mg [Prunus persica] Length = 224 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = -3 Query: 155 CWKLIQKPGKKEHHLWQKRDSAGSGQKAMDLVHTISRLPNEKEAVYGALDK 3 C K I+K G+KEHHLWQKRDSAGSGQKA++LV +S LPNEKE VYGALDK Sbjct: 3 CRKTIKKVGRKEHHLWQKRDSAGSGQKALNLVRIVSGLPNEKETVYGALDK 53 >gb|EOY27863.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] Length = 276 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/49 (77%), Positives = 44/49 (89%) Frame = -3 Query: 149 KLIQKPGKKEHHLWQKRDSAGSGQKAMDLVHTISRLPNEKEAVYGALDK 3 K ++K GK EHHLW+KRDSAGSGQKA++LV IS+LPNEKEAVYGALDK Sbjct: 62 KPVKKVGKNEHHLWKKRDSAGSGQKALNLVRIISQLPNEKEAVYGALDK 110 >ref|XP_006449586.1| hypothetical protein CICLE_v10016169mg [Citrus clementina] gi|557552197|gb|ESR62826.1| hypothetical protein CICLE_v10016169mg [Citrus clementina] Length = 284 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = -3 Query: 149 KLIQKPGKKEHHLWQKRDSAGSGQKAMDLVHTISRLPNEKEAVYGALDK 3 KL+ K GKKE HLWQKRDSAGSGQKA++LV +S LPNEK AVYGALDK Sbjct: 66 KLVVKVGKKEQHLWQKRDSAGSGQKALNLVRIVSELPNEKHAVYGALDK 114 >ref|XP_006355563.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18975, chloroplastic-like isoform X1 [Solanum tuberosum] gi|565378234|ref|XP_006355564.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18975, chloroplastic-like isoform X2 [Solanum tuberosum] gi|565378236|ref|XP_006355565.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18975, chloroplastic-like isoform X3 [Solanum tuberosum] Length = 265 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -3 Query: 149 KLIQKPGKKEHHLWQKRDSAGSGQKAMDLVHTISRLPNEKEAVYGALDK 3 K +QK GK EHHLW+KR+SAGSGQKA++LV IS LPNEKE+VYGALDK Sbjct: 54 KKVQKAGKVEHHLWKKRESAGSGQKALNLVRIISGLPNEKESVYGALDK 102 >ref|XP_004232997.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18975, chloroplastic-like [Solanum lycopersicum] Length = 265 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -3 Query: 149 KLIQKPGKKEHHLWQKRDSAGSGQKAMDLVHTISRLPNEKEAVYGALDK 3 K +QK GK EHHLW+KR+SAGSGQKA++LV IS LPNEKE+VYGALDK Sbjct: 54 KKVQKAGKVEHHLWKKRESAGSGQKALNLVRIISGLPNEKESVYGALDK 102 >ref|XP_002269512.2| PREDICTED: pentatricopeptide repeat-containing protein At4g18975, chloroplastic-like [Vitis vinifera] Length = 216 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -3 Query: 149 KLIQKPGKKEHHLWQKRDSAGSGQKAMDLVHTISRLPNEKEAVYGALDK 3 ++ +K GKKEHHLW+KRDS GSGQKA++LV +S LPNEKEAVYGALDK Sbjct: 62 EISKKVGKKEHHLWRKRDSIGSGQKALNLVRIVSELPNEKEAVYGALDK 110 >emb|CBI30774.3| unnamed protein product [Vitis vinifera] Length = 277 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -3 Query: 149 KLIQKPGKKEHHLWQKRDSAGSGQKAMDLVHTISRLPNEKEAVYGALDK 3 ++ +K GKKEHHLW+KRDS GSGQKA++LV +S LPNEKEAVYGALDK Sbjct: 62 EISKKVGKKEHHLWRKRDSIGSGQKALNLVRIVSELPNEKEAVYGALDK 110 >ref|XP_004294568.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18975, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 300 Score = 79.0 bits (193), Expect = 6e-13 Identities = 33/49 (67%), Positives = 44/49 (89%) Frame = -3 Query: 149 KLIQKPGKKEHHLWQKRDSAGSGQKAMDLVHTISRLPNEKEAVYGALDK 3 K+I+K G+ EHHLW+K+DSAGSGQKA++L+ +S LPNEKEA++GALDK Sbjct: 81 KIIKKAGRNEHHLWKKKDSAGSGQKALNLIRIVSDLPNEKEAIFGALDK 129 >ref|NP_001031667.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332658716|gb|AEE84116.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 260 Score = 79.0 bits (193), Expect = 6e-13 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -3 Query: 149 KLIQKPGKKEHHLWQKRDSAGSGQKAMDLVHTISRLPNEKEAVYGALDK 3 K I+K GKKEHHLW+K DSAGSGQKA++LV +S LPNEKEAVYGAL+K Sbjct: 46 KEIKKVGKKEHHLWKKNDSAGSGQKALNLVRMLSGLPNEKEAVYGALNK 94 >ref|NP_567571.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|186512032|ref|NP_001119009.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|334186688|ref|NP_001190768.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635632|sp|Q2V3H0.2|PP322_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g18975, chloroplastic; Flags: Precursor gi|332658715|gb|AEE84115.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332658717|gb|AEE84117.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332658718|gb|AEE84118.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 287 Score = 79.0 bits (193), Expect = 6e-13 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -3 Query: 149 KLIQKPGKKEHHLWQKRDSAGSGQKAMDLVHTISRLPNEKEAVYGALDK 3 K I+K GKKEHHLW+K DSAGSGQKA++LV +S LPNEKEAVYGAL+K Sbjct: 73 KEIKKVGKKEHHLWKKNDSAGSGQKALNLVRMLSGLPNEKEAVYGALNK 121 >gb|AAT06467.1| At4g18975 [Arabidopsis thaliana] gi|62320588|dbj|BAD95227.1| hypothetical protein [Arabidopsis thaliana] Length = 152 Score = 79.0 bits (193), Expect = 6e-13 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -3 Query: 149 KLIQKPGKKEHHLWQKRDSAGSGQKAMDLVHTISRLPNEKEAVYGALDK 3 K I+K GKKEHHLW+K DSAGSGQKA++LV +S LPNEKEAVYGAL+K Sbjct: 73 KEIKKVGKKEHHLWKKNDSAGSGQKALNLVRMLSGLPNEKEAVYGALNK 121 >emb|CAA16754.1| putative protein [Arabidopsis thaliana] gi|7268691|emb|CAB78899.1| putative protein [Arabidopsis thaliana] Length = 626 Score = 79.0 bits (193), Expect = 6e-13 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -3 Query: 149 KLIQKPGKKEHHLWQKRDSAGSGQKAMDLVHTISRLPNEKEAVYGALDK 3 K I+K GKKEHHLW+K DSAGSGQKA++LV +S LPNEKEAVYGAL+K Sbjct: 46 KEIKKVGKKEHHLWKKNDSAGSGQKALNLVRMLSGLPNEKEAVYGALNK 94 >ref|XP_002867967.1| hypothetical protein ARALYDRAFT_914772 [Arabidopsis lyrata subsp. lyrata] gi|297313803|gb|EFH44226.1| hypothetical protein ARALYDRAFT_914772 [Arabidopsis lyrata subsp. lyrata] Length = 284 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = -3 Query: 143 IQKPGKKEHHLWQKRDSAGSGQKAMDLVHTISRLPNEKEAVYGALDK 3 I+K GKKEHHLW+K DSAGSGQKA++LV +S LPNEKEAVYGAL+K Sbjct: 72 IKKVGKKEHHLWKKNDSAGSGQKALNLVRMLSGLPNEKEAVYGALNK 118 >gb|EXB58283.1| hypothetical protein L484_015617 [Morus notabilis] Length = 326 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/56 (62%), Positives = 46/56 (82%) Frame = -3 Query: 170 FNYI*CWKLIQKPGKKEHHLWQKRDSAGSGQKAMDLVHTISRLPNEKEAVYGALDK 3 F Y+ L++K GKKE+HLW+K+DSAGSGQKA++L+ +S LPNEKE VYGAL+K Sbjct: 100 FLYMEFRNLVKKTGKKEYHLWKKKDSAGSGQKALNLIRILSVLPNEKEVVYGALNK 155 >dbj|BAC83317.1| pentatricopeptide (PPR) repeat-containing protein-like protein [Oryza sativa Japonica Group] gi|125600619|gb|EAZ40195.1| hypothetical protein OsJ_24640 [Oryza sativa Japonica Group] Length = 253 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = -3 Query: 146 LIQKPGKKEHHLWQKRDSAGSGQKAMDLVHTISRLPNEKEAVYGALDK 3 L+ K KEHHLW ++DSAGSG+KA+ LV+T+S+LPNEKEAVYGALDK Sbjct: 40 LVSKKPNKEHHLWIRKDSAGSGKKALHLVNTVSKLPNEKEAVYGALDK 87 >gb|EAZ04241.1| hypothetical protein OsI_26386 [Oryza sativa Indica Group] Length = 253 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = -3 Query: 146 LIQKPGKKEHHLWQKRDSAGSGQKAMDLVHTISRLPNEKEAVYGALDK 3 L+ K KEHHLW ++DSAGSG+KA+ LV+T+S+LPNEKEAVYGALDK Sbjct: 40 LLSKKPNKEHHLWIRKDSAGSGKKALHLVNTVSKLPNEKEAVYGALDK 87 >ref|XP_006658667.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18975, chloroplastic-like [Oryza brachyantha] Length = 230 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/54 (61%), Positives = 44/54 (81%) Frame = -3 Query: 164 YI*CWKLIQKPGKKEHHLWQKRDSAGSGQKAMDLVHTISRLPNEKEAVYGALDK 3 ++ C + K K+HHLW ++DSAGSG+KA+ LV+T+S+LPNEKEAVYGALDK Sbjct: 12 FVYCGYRVSKKPNKQHHLWIRKDSAGSGKKALRLVNTVSKLPNEKEAVYGALDK 65 >ref|XP_006467567.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18975, chloroplastic-like [Citrus sinensis] Length = 281 Score = 75.5 bits (184), Expect = 7e-12 Identities = 38/49 (77%), Positives = 41/49 (83%) Frame = -3 Query: 149 KLIQKPGKKEHHLWQKRDSAGSGQKAMDLVHTISRLPNEKEAVYGALDK 3 KL+ K GKKE HLWQKRDSAGSGQKA++LV S LPNEK AVYGALDK Sbjct: 66 KLVVKVGKKEQHLWQKRDSAGSGQKALNLV---SELPNEKHAVYGALDK 111 >gb|ESW19954.1| hypothetical protein PHAVU_006G168700g [Phaseolus vulgaris] Length = 289 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -3 Query: 131 GKKEHHLWQKRDSAGSGQKAMDLVHTISRLPNEKEAVYGALDK 3 GKKEHHLW+ RDSA SGQKA+ LV +S+LPNEKEAVYGALDK Sbjct: 77 GKKEHHLWKSRDSAQSGQKALTLVRIVSKLPNEKEAVYGALDK 119