BLASTX nr result
ID: Rehmannia23_contig00018566
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00018566 (307 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004968948.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 117 2e-24 ref|XP_004960988.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 117 2e-24 gb|EOY29498.1| DEAD/DEAH box RNA helicase family protein isoform... 117 2e-24 gb|EOY29497.1| DEAD/DEAH box RNA helicase family protein isoform... 117 2e-24 gb|AFW81346.1| hypothetical protein ZEAMMB73_015937 [Zea mays] 117 2e-24 gb|AFW81342.1| spliceosome RNA helicase BAT1 isoform 1 [Zea mays... 117 2e-24 ref|XP_003569187.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 117 2e-24 ref|XP_003569186.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 117 2e-24 ref|XP_003569181.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 117 2e-24 ref|XP_002268833.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 117 2e-24 ref|XP_002285072.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 117 2e-24 ref|NP_001141599.1| uncharacterized protein LOC100273717 [Zea ma... 117 2e-24 ref|XP_002535684.1| dead box ATP-dependent RNA helicase, putativ... 117 2e-24 ref|XP_002324856.1| hypothetical protein POPTR_0018s01620g [Popu... 117 2e-24 ref|XP_002309623.1| hypothetical protein POPTR_0006s26940g [Popu... 117 2e-24 gb|ACF86701.1| unknown [Zea mays] 117 2e-24 gb|ABK93079.1| unknown [Populus trichocarpa] 117 2e-24 ref|XP_006346267.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 116 4e-24 ref|XP_006346265.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 116 4e-24 ref|XP_006853982.1| hypothetical protein AMTR_s00036p00225190 [A... 116 4e-24 >ref|XP_004968948.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform X2 [Setaria italica] Length = 429 Score = 117 bits (293), Expect = 2e-24 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 3 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 176 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 372 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 429 >ref|XP_004960988.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform X2 [Setaria italica] Length = 429 Score = 117 bits (293), Expect = 2e-24 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 3 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 176 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 372 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 429 >gb|EOY29498.1| DEAD/DEAH box RNA helicase family protein isoform 2 [Theobroma cacao] Length = 428 Score = 117 bits (293), Expect = 2e-24 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 3 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 176 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 371 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 428 >gb|EOY29497.1| DEAD/DEAH box RNA helicase family protein isoform 1 [Theobroma cacao] Length = 485 Score = 117 bits (293), Expect = 2e-24 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 3 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 176 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 428 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 485 >gb|AFW81346.1| hypothetical protein ZEAMMB73_015937 [Zea mays] Length = 344 Score = 117 bits (293), Expect = 2e-24 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 3 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 176 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 287 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 344 >gb|AFW81342.1| spliceosome RNA helicase BAT1 isoform 1 [Zea mays] gi|413948694|gb|AFW81343.1| spliceosome RNA helicase BAT1 isoform 2 [Zea mays] gi|413948695|gb|AFW81344.1| spliceosome RNA helicase BAT1 isoform 3 [Zea mays] Length = 429 Score = 117 bits (293), Expect = 2e-24 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 3 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 176 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 372 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 429 >ref|XP_003569187.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brachypodium distachyon] Length = 428 Score = 117 bits (293), Expect = 2e-24 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 3 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 176 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 371 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 428 >ref|XP_003569186.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brachypodium distachyon] Length = 429 Score = 117 bits (293), Expect = 2e-24 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 3 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 176 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 372 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 429 >ref|XP_003569181.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brachypodium distachyon] Length = 428 Score = 117 bits (293), Expect = 2e-24 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 3 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 176 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 371 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 428 >ref|XP_002268833.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Vitis vinifera] gi|297743441|emb|CBI36308.3| unnamed protein product [Vitis vinifera] Length = 428 Score = 117 bits (293), Expect = 2e-24 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 3 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 176 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 371 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 428 >ref|XP_002285072.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Vitis vinifera] Length = 428 Score = 117 bits (293), Expect = 2e-24 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 3 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 176 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 371 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 428 >ref|NP_001141599.1| uncharacterized protein LOC100273717 [Zea mays] gi|224032233|gb|ACN35192.1| unknown [Zea mays] Length = 429 Score = 117 bits (293), Expect = 2e-24 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 3 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 176 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 372 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 429 >ref|XP_002535684.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223522292|gb|EEF26699.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] Length = 105 Score = 117 bits (293), Expect = 2e-24 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 3 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 176 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 48 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 105 >ref|XP_002324856.1| hypothetical protein POPTR_0018s01620g [Populus trichocarpa] gi|222866290|gb|EEF03421.1| hypothetical protein POPTR_0018s01620g [Populus trichocarpa] Length = 428 Score = 117 bits (293), Expect = 2e-24 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 3 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 176 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 371 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 428 >ref|XP_002309623.1| hypothetical protein POPTR_0006s26940g [Populus trichocarpa] gi|222855599|gb|EEE93146.1| hypothetical protein POPTR_0006s26940g [Populus trichocarpa] Length = 428 Score = 117 bits (293), Expect = 2e-24 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 3 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 176 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 371 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 428 >gb|ACF86701.1| unknown [Zea mays] Length = 106 Score = 117 bits (293), Expect = 2e-24 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 3 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 176 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 49 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 106 >gb|ABK93079.1| unknown [Populus trichocarpa] Length = 428 Score = 117 bits (293), Expect = 2e-24 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = +3 Query: 3 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 176 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 371 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 428 >ref|XP_006346267.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform X3 [Solanum tuberosum] Length = 344 Score = 116 bits (290), Expect = 4e-24 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = +3 Query: 3 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 176 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQ+RFEVDIKELPEQIDTSTYMPS Sbjct: 287 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQQRFEVDIKELPEQIDTSTYMPS 344 >ref|XP_006346265.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform X1 [Solanum tuberosum] gi|565358907|ref|XP_006346266.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform X2 [Solanum tuberosum] Length = 428 Score = 116 bits (290), Expect = 4e-24 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = +3 Query: 3 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 176 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQ+RFEVDIKELPEQIDTSTYMPS Sbjct: 371 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQQRFEVDIKELPEQIDTSTYMPS 428 >ref|XP_006853982.1| hypothetical protein AMTR_s00036p00225190 [Amborella trichopoda] gi|548857650|gb|ERN15449.1| hypothetical protein AMTR_s00036p00225190 [Amborella trichopoda] Length = 428 Score = 116 bits (290), Expect = 4e-24 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = +3 Query: 3 DTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 176 DTYLHRVGRAGRFGTKGLAITFV+SASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS Sbjct: 371 DTYLHRVGRAGRFGTKGLAITFVASASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS 428