BLASTX nr result
ID: Rehmannia23_contig00018260
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00018260 (400 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272401.1| PREDICTED: scarecrow-like protein 13 [Vitis ... 57 2e-06 ref|XP_002534218.1| Chitin-inducible gibberellin-responsive prot... 57 3e-06 gb|EXB56655.1| hypothetical protein L484_004260 [Morus notabilis] 56 6e-06 gb|EOY28931.1| SCL domain class transcription factor [Theobroma ... 55 7e-06 >ref|XP_002272401.1| PREDICTED: scarecrow-like protein 13 [Vitis vinifera] Length = 545 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/61 (44%), Positives = 40/61 (65%), Gaps = 1/61 (1%) Frame = -3 Query: 182 MQASQESQTSNPYHIFYNRPMQQIDPYGIPTFQVL-NNDSTGSKSQGTEVSFQTYNEQFF 6 MQ S+E Q+S H Y++P+Q++ PY + Q+L NN+ + Q T +SF TYNEQ+F Sbjct: 1 MQTSEEHQSSGGIHRLYHQPVQELQPYCLSEIQILDNNECPSNGIQQTHLSFGTYNEQYF 60 Query: 5 T 3 T Sbjct: 61 T 61 >ref|XP_002534218.1| Chitin-inducible gibberellin-responsive protein, putative [Ricinus communis] gi|223525687|gb|EEF28164.1| Chitin-inducible gibberellin-responsive protein, putative [Ricinus communis] Length = 542 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/61 (49%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Frame = -3 Query: 182 MQASQESQTSNPYHIFYNRPMQQIDPYGIPTFQVLNNDSTGSK-SQGTEVSFQTYNEQFF 6 MQ SQ+ + H FYN P Q+ID YG+ Q+L N + SQGT VSFQTY E++F Sbjct: 1 MQTSQKHRNPAGIHGFYNHP-QEIDQYGLSHIQILENSAFSDVGSQGTSVSFQTYKEEYF 59 Query: 5 T 3 T Sbjct: 60 T 60 >gb|EXB56655.1| hypothetical protein L484_004260 [Morus notabilis] Length = 597 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/66 (45%), Positives = 40/66 (60%), Gaps = 1/66 (1%) Frame = -3 Query: 197 AAFLEMQASQESQTSNPYHIFYNRPMQQIDPYGIPTFQVL-NNDSTGSKSQGTEVSFQTY 21 A L MQ SQ+ Q + H Y + +Q I+PY P FQ+L NN + SQG +SF+T Sbjct: 44 AKVLRMQTSQKHQATGGIHGLYQQHVQDINPYYSPHFQILENNMFPDTGSQGKSLSFETC 103 Query: 20 NEQFFT 3 NEQ+FT Sbjct: 104 NEQYFT 109 >gb|EOY28931.1| SCL domain class transcription factor [Theobroma cacao] Length = 548 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/61 (47%), Positives = 40/61 (65%), Gaps = 1/61 (1%) Frame = -3 Query: 182 MQASQESQTSNPYHIFYNRPMQQIDPYGIPTFQVL-NNDSTGSKSQGTEVSFQTYNEQFF 6 MQ SQ+ QTS Y++P+Q+++ +P Q+L NN + SQGT VSFQTY +QFF Sbjct: 1 MQTSQKHQTSACIRRLYHQPVQEMEALCLPHIQILDNNVCSDVGSQGTSVSFQTYKDQFF 60 Query: 5 T 3 T Sbjct: 61 T 61