BLASTX nr result
ID: Rehmannia23_contig00018043
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00018043 (506 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ10728.1| hypothetical protein PRUPE_ppa010644mg [Prunus pe... 78 1e-12 gb|AFQ95411.1| 2C-methyl-D-erythritol 2,4-cyclodiphosphate synth... 77 2e-12 gb|AEZ55667.1| 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synt... 77 2e-12 ref|XP_006343929.1| PREDICTED: 2-C-methyl-D-erythritol 2,4-cyclo... 77 2e-12 gb|AGT36574.1| 2-C-methyl-d-erythritol 2,4-cyclodiphosphate synt... 77 2e-12 gb|EPS61074.1| hypothetical protein M569_13727, partial [Genlise... 77 2e-12 ref|XP_004245566.1| PREDICTED: 2-C-methyl-D-erythritol 2,4-cyclo... 77 2e-12 gb|ABV02020.1| 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synt... 77 2e-12 gb|EOY24852.1| 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synt... 77 3e-12 ref|XP_006302770.1| hypothetical protein CARUB_v10020891mg [Caps... 77 3e-12 gb|EMS45423.1| 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synt... 77 3e-12 ref|XP_004298833.1| PREDICTED: 2-C-methyl-D-erythritol 2,4-cyclo... 77 3e-12 ref|NP_850971.1| 2-C-methyl-D-erythritol 2,4-cyclodiphosphate sy... 77 3e-12 gb|AAM62786.1| 2C-methyl-D-erythritol 2,4-cyclodiphosphate synth... 77 3e-12 ref|NP_564819.2| 2-C-methyl-D-erythritol 2,4-cyclodiphosphate sy... 77 3e-12 gb|AFB70982.1| 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synt... 77 3e-12 dbj|BAK03169.1| predicted protein [Hordeum vulgare subsp. vulgar... 77 3e-12 gb|ABV89583.1| plastid 2C-methyl-D-erythritol 2,4-cyclodiphospha... 77 3e-12 ref|XP_002886373.1| 2C-methyl-D-erythritol 2,4-cyclodiphosphate ... 77 3e-12 gb|ADF28651.1| 2-methylerythritol 2,4-cyclodiphosphate synthase ... 77 3e-12 >gb|EMJ10728.1| hypothetical protein PRUPE_ppa010644mg [Prunus persica] Length = 241 Score = 78.2 bits (191), Expect = 1e-12 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = +3 Query: 3 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLVRK 122 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLL+RK Sbjct: 202 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLMRK 241 >gb|AFQ95411.1| 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Salvia miltiorrhiza] Length = 234 Score = 77.4 bits (189), Expect = 2e-12 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = +3 Query: 3 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLVRK 122 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLL RK Sbjct: 195 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLFRK 234 >gb|AEZ55667.1| 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Salvia miltiorrhiza] Length = 234 Score = 77.4 bits (189), Expect = 2e-12 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = +3 Query: 3 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLVRK 122 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLL RK Sbjct: 195 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLFRK 234 >ref|XP_006343929.1| PREDICTED: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplastic-like [Solanum tuberosum] Length = 227 Score = 77.0 bits (188), Expect = 2e-12 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +3 Query: 3 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLVRK 122 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLL++K Sbjct: 188 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLMKK 227 >gb|AGT36574.1| 2-C-methyl-d-erythritol 2,4-cyclodiphosphate synthase [Nicotiana sylvestris] Length = 317 Score = 77.0 bits (188), Expect = 2e-12 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +3 Query: 3 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLVRK 122 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLL++K Sbjct: 278 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLMKK 317 >gb|EPS61074.1| hypothetical protein M569_13727, partial [Genlisea aurea] Length = 229 Score = 77.0 bits (188), Expect = 2e-12 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +3 Query: 3 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLVRK 122 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLL++K Sbjct: 190 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLMKK 229 >ref|XP_004245566.1| PREDICTED: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplastic-like [Solanum lycopersicum] Length = 256 Score = 77.0 bits (188), Expect = 2e-12 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +3 Query: 3 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLVRK 122 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLL++K Sbjct: 217 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLMKK 256 >gb|ABV02020.1| 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Nicotiana langsdorffii x Nicotiana sanderae] Length = 135 Score = 77.0 bits (188), Expect = 2e-12 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +3 Query: 3 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLVRK 122 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLL++K Sbjct: 96 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLMKK 135 >gb|EOY24852.1| 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Theobroma cacao] Length = 356 Score = 76.6 bits (187), Expect = 3e-12 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +3 Query: 3 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLVRK 122 +LLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLL+RK Sbjct: 317 ELLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLMRK 356 >ref|XP_006302770.1| hypothetical protein CARUB_v10020891mg [Capsella rubella] gi|482571480|gb|EOA35668.1| hypothetical protein CARUB_v10020891mg [Capsella rubella] Length = 231 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLVRK 122 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTV+LL++K Sbjct: 192 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVILLMKK 231 >gb|EMS45423.1| 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplastic [Triticum urartu] Length = 139 Score = 76.6 bits (187), Expect = 3e-12 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +3 Query: 3 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLVRK 122 +LLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLL+RK Sbjct: 100 ELLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLMRK 139 >ref|XP_004298833.1| PREDICTED: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 226 Score = 76.6 bits (187), Expect = 3e-12 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +3 Query: 3 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLVRK 122 KLLG DPSVVNLKAKTHEKVDSLGENRSIAAHTVVLL+RK Sbjct: 187 KLLGVDPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLMRK 226 >ref|NP_850971.1| 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Arabidopsis thaliana] gi|27805483|sp|Q9CAK8.1|ISPF_ARATH RecName: Full=2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplastic; Short=MECDP-synthase; Short=MECPS; Short=MECS; Flags: Precursor gi|12325003|gb|AAG52445.1|AC010852_2 unknown protein; 376-1789 [Arabidopsis thaliana] gi|13877783|gb|AAK43969.1|AF370154_1 unknown protein [Arabidopsis thaliana] gi|16323416|gb|AAL15202.1| unknown protein [Arabidopsis thaliana] gi|332196053|gb|AEE34174.1| 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Arabidopsis thaliana] Length = 231 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLVRK 122 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTV+LL++K Sbjct: 192 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVILLMKK 231 >gb|AAM62786.1| 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Arabidopsis thaliana] Length = 231 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLVRK 122 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTV+LL++K Sbjct: 192 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVILLMKK 231 >ref|NP_564819.2| 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Arabidopsis thaliana] gi|332196054|gb|AEE34175.1| 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Arabidopsis thaliana] Length = 223 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLVRK 122 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTV+LL++K Sbjct: 184 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVILLMKK 223 >gb|AFB70982.1| 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Mitragyna speciosa] Length = 240 Score = 76.6 bits (187), Expect = 3e-12 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +3 Query: 3 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLVRK 122 +LLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLL+RK Sbjct: 201 QLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLMRK 240 >dbj|BAK03169.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326509287|dbj|BAJ91560.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326526659|dbj|BAK00718.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 227 Score = 76.6 bits (187), Expect = 3e-12 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +3 Query: 3 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLVRK 122 +LLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLL+RK Sbjct: 188 ELLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLMRK 227 >gb|ABV89583.1| plastid 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Rauvolfia verticillata] Length = 238 Score = 76.6 bits (187), Expect = 3e-12 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +3 Query: 3 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLVRK 122 +LLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLL+RK Sbjct: 199 QLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLMRK 238 >ref|XP_002886373.1| 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Arabidopsis lyrata subsp. lyrata] gi|297332214|gb|EFH62632.1| 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Arabidopsis lyrata subsp. lyrata] Length = 231 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLVRK 122 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTV+LL++K Sbjct: 192 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVILLMKK 231 >gb|ADF28651.1| 2-methylerythritol 2,4-cyclodiphosphate synthase [Expression vector pCDS-At] Length = 168 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 3 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLVRK 122 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTV+LL++K Sbjct: 129 KLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVILLMKK 168