BLASTX nr result
ID: Rehmannia23_contig00017900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00017900 (324 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004492989.1| PREDICTED: acyltransferase-like protein At3g... 53 3e-07 ref|XP_003624436.1| Acyltransferase-like protein [Medicago trunc... 51 2e-06 >ref|XP_004492989.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic-like [Cicer arietinum] Length = 659 Score = 53.1 bits (126), Expect(2) = 3e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -1 Query: 240 LALAVAGRNPDIDLILILATPATSFSKSQFSAAT 139 LALAVA RNPDIDL+LILA PATSFS+SQ T Sbjct: 157 LALAVAARNPDIDLVLILANPATSFSRSQLQLVT 190 Score = 26.9 bits (58), Expect(2) = 3e-07 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 322 DLVKLVESTVRLQYSR 275 DLVKLVE TVR +Y R Sbjct: 125 DLVKLVEKTVRSEYQR 140 >ref|XP_003624436.1| Acyltransferase-like protein [Medicago truncatula] gi|355499451|gb|AES80654.1| Acyltransferase-like protein [Medicago truncatula] Length = 697 Score = 50.8 bits (120), Expect(2) = 2e-06 Identities = 31/56 (55%), Positives = 36/56 (64%) Frame = -1 Query: 240 LALAVAGRNPDIDLILILATPATSFSKSQFSAATTNSSTVVDIDP*ATPF*LALYA 73 LALAVA RN DIDL+LIL+ PATSFS+SQ T T+ D A P L+L A Sbjct: 196 LALAVAARNRDIDLVLILSNPATSFSRSQLQFVTPLLETLPDSLSPALPNILSLTA 251 Score = 26.6 bits (57), Expect(2) = 2e-06 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 322 DLVKLVESTVRLQYSR 275 DLVKLVE TVR +Y R Sbjct: 164 DLVKLVERTVRSEYER 179