BLASTX nr result
ID: Rehmannia23_contig00016642
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00016642 (385 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC27870.1| hypothetical protein L484_009192 [Morus notabilis] 60 3e-07 >gb|EXC27870.1| hypothetical protein L484_009192 [Morus notabilis] Length = 94 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/62 (45%), Positives = 35/62 (56%), Gaps = 5/62 (8%) Frame = +2 Query: 167 ILWRAKVHVERWSVWLERNNRIFNESEETSLECWD-----ISSWVKGNKEFKHLFVSDLT 331 +LW+ + W +WLERN RIF EE S+ WD I+ W+ NKEF L SDL Sbjct: 29 VLWKVAMMAIWWRIWLERNRRIFERREEDSIITWDRIKLNIALWIHSNKEFCDLLYSDLV 88 Query: 332 RD 337 RD Sbjct: 89 RD 90