BLASTX nr result
ID: Rehmannia23_contig00016487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00016487 (523 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG43556.1|AF211538_1 Avr9/Cf-9 rapidly elicited protein 180 ... 61 1e-07 gb|EPS64142.1| hypothetical protein M569_10641 [Genlisea aurea] 55 1e-05 >gb|AAG43556.1|AF211538_1 Avr9/Cf-9 rapidly elicited protein 180 [Nicotiana tabacum] Length = 102 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/45 (66%), Positives = 36/45 (80%), Gaps = 3/45 (6%) Frame = -1 Query: 379 WKLKS-SAGLRWKKR--FNLHLWFVDGFLFKIVSVFEAVVLVSTL 254 W+ K+ S+GLRW K+ + LH WFVD FLFKIVSVFEA+ LVSTL Sbjct: 47 WRFKNLSSGLRWNKKSLYKLHHWFVDSFLFKIVSVFEAIALVSTL 91 >gb|EPS64142.1| hypothetical protein M569_10641 [Genlisea aurea] Length = 110 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/55 (50%), Positives = 33/55 (60%) Frame = +3 Query: 216 NQKWHPQQRKKAQSVETNTTASKTETILKRNPSTNHRCKLNRFFHRKPAELFNFH 380 NQ W PQQ KK Q V+ TTAS+ E IL R ST + LN F H PA+ +FH Sbjct: 2 NQSWQPQQTKKQQRVDPITTASRIERILNRKTSTKFKLNLN-FHHLSPADPLSFH 55