BLASTX nr result
ID: Rehmannia23_contig00016235
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00016235 (397 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271696.1| PREDICTED: thioredoxin domain-containing pro... 41 2e-07 emb|CAN66100.1| hypothetical protein VITISV_013928 [Vitis vinifera] 41 2e-07 >ref|XP_002271696.1| PREDICTED: thioredoxin domain-containing protein 9 homolog [Vitis vinifera] gi|296083094|emb|CBI22498.3| unnamed protein product [Vitis vinifera] Length = 212 Score = 40.8 bits (94), Expect(2) = 2e-07 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = +3 Query: 12 EKSIFVQEA-QIVVLPTLARVKNAKVDDYV 98 EKS F+ E +IVVLPTLA +KNAKVDDYV Sbjct: 124 EKSPFLAEKLKIVVLPTLALIKNAKVDDYV 153 Score = 39.7 bits (91), Expect(2) = 2e-07 Identities = 24/48 (50%), Positives = 30/48 (62%) Frame = +1 Query: 100 TEELEERLAK*PRLLFMMENHLRSHPNPKLDPSRNVRQGSTSYSSHSE 243 TEELEERLAK ++F E+ L H + R+VRQ S SYSS S+ Sbjct: 167 TEELEERLAKAQVIIFEGESSL--HASKSSSQPRSVRQSSNSYSSDSD 212 >emb|CAN66100.1| hypothetical protein VITISV_013928 [Vitis vinifera] Length = 207 Score = 40.8 bits (94), Expect(2) = 2e-07 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 1/30 (3%) Frame = +3 Query: 12 EKSIFVQEA-QIVVLPTLARVKNAKVDDYV 98 EKS F+ E +IVVLPTLA +KNAKVDDYV Sbjct: 119 EKSPFLAEKLKIVVLPTLALIKNAKVDDYV 148 Score = 39.7 bits (91), Expect(2) = 2e-07 Identities = 24/48 (50%), Positives = 30/48 (62%) Frame = +1 Query: 100 TEELEERLAK*PRLLFMMENHLRSHPNPKLDPSRNVRQGSTSYSSHSE 243 TEELEERLAK ++F E+ L H + R+VRQ S SYSS S+ Sbjct: 162 TEELEERLAKAQVIIFEGESSL--HASKSSSQPRSVRQSSNSYSSDSD 207