BLASTX nr result
ID: Rehmannia23_contig00015225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00015225 (803 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS68471.1| hypothetical protein M569_06301 [Genlisea aurea] 67 7e-09 >gb|EPS68471.1| hypothetical protein M569_06301 [Genlisea aurea] Length = 327 Score = 67.0 bits (162), Expect = 7e-09 Identities = 41/136 (30%), Positives = 75/136 (55%) Frame = +2 Query: 206 SKQSEDTLVKETTSGENKENINFQEGGFDYNQATVPKLDGINKVTDGEQEVAPANSSSIG 385 S + ED + ++ +G+ + + QE F+ A + + +G++E P N + Sbjct: 17 SAKRED-IGQQAYTGDKEGTQDLQEVCFNGKSAISQR-----SLLEGKKEAYPLNGTGEM 70 Query: 386 GVLMVNNQTGDCAIQIAKEQVNADIVLDNQMDDFGTLEELKVDNEFSIHDYSEVLDSCFV 565 + +V Q DC +I E+ + + D QMD+FG EL VD++ IHD+SEVL++C Sbjct: 71 EIGVVKTQKVDCVSEIVHEKESGNACSDMQMDEFGNCGELPVDDDLFIHDFSEVLNTCMS 130 Query: 566 MDMVIESSKTVEDSQE 613 +DM +S+++ED ++ Sbjct: 131 VDM---TSESLEDGEK 143