BLASTX nr result
ID: Rehmannia23_contig00015189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00015189 (456 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006381437.1| hypothetical protein POPTR_0006s12830g [Popu... 57 3e-06 >ref|XP_006381437.1| hypothetical protein POPTR_0006s12830g [Populus trichocarpa] gi|550336140|gb|ERP59234.1| hypothetical protein POPTR_0006s12830g [Populus trichocarpa] Length = 183 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/73 (36%), Positives = 38/73 (52%), Gaps = 5/73 (6%) Frame = -2 Query: 371 KMKVVAFVLISLMTSLCFAAPRRALLSSV-----RNDVGEESVAENINTNKERIPDGTVE 207 K +V ++ M C AAPRR ++ + R VG + E T+K PD ++ Sbjct: 2 KQAIVFIFVVMFMVGSCMAAPRREMIGGIYGQEQRQHVGRGKIIEG-RTSKVHYPDRNID 60 Query: 206 NHHNIPRQYYNQW 168 NHH+IPRQ YN W Sbjct: 61 NHHSIPRQNYNDW 73