BLASTX nr result
ID: Rehmannia23_contig00015184
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00015184 (425 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOX92888.1| Pentatricopeptide repeat superfamily protein, put... 64 2e-08 gb|EOX92886.1| Pentatricopeptide repeat superfamily protein, put... 64 2e-08 gb|EOX92885.1| Pentatricopeptide repeat superfamily protein, put... 64 2e-08 ref|XP_004243786.1| PREDICTED: putative pentatricopeptide repeat... 63 4e-08 ref|XP_004232338.1| PREDICTED: putative pentatricopeptide repeat... 63 4e-08 ref|XP_006357835.1| PREDICTED: putative pentatricopeptide repeat... 63 5e-08 emb|CBI26532.3| unnamed protein product [Vitis vinifera] 62 1e-07 ref|XP_002274300.1| PREDICTED: putative pentatricopeptide repeat... 62 1e-07 ref|XP_006348886.1| PREDICTED: putative pentatricopeptide repeat... 60 3e-07 gb|EXB92364.1| hypothetical protein L484_021348 [Morus notabilis] 59 5e-07 ref|XP_004151692.1| PREDICTED: putative pentatricopeptide repeat... 58 1e-06 ref|XP_002532784.1| pentatricopeptide repeat-containing protein,... 56 6e-06 >gb|EOX92888.1| Pentatricopeptide repeat superfamily protein, putative isoform 4 [Theobroma cacao] gi|508700993|gb|EOX92889.1| Pentatricopeptide repeat superfamily protein, putative isoform 4 [Theobroma cacao] Length = 490 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/55 (56%), Positives = 42/55 (76%) Frame = +2 Query: 5 RYRLAAKLLLSCIRDGMRTLKADQRAVLKGLSLTGSKWDAKKFKQKMRIAKLLYY 169 RYR A+KLLLSC+R GM+ LK+ QRAVL GL +G +A+K + K+RIA++L Y Sbjct: 436 RYRSASKLLLSCLRSGMKILKSAQRAVLSGLRYSGFPGEARKVQSKIRIARILNY 490 >gb|EOX92886.1| Pentatricopeptide repeat superfamily protein, putative isoform 2 [Theobroma cacao] gi|508700991|gb|EOX92887.1| Pentatricopeptide repeat superfamily protein, putative isoform 2 [Theobroma cacao] Length = 457 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/55 (56%), Positives = 42/55 (76%) Frame = +2 Query: 5 RYRLAAKLLLSCIRDGMRTLKADQRAVLKGLSLTGSKWDAKKFKQKMRIAKLLYY 169 RYR A+KLLLSC+R GM+ LK+ QRAVL GL +G +A+K + K+RIA++L Y Sbjct: 403 RYRSASKLLLSCLRSGMKILKSAQRAVLSGLRYSGFPGEARKVQSKIRIARILNY 457 >gb|EOX92885.1| Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] Length = 505 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/55 (56%), Positives = 42/55 (76%) Frame = +2 Query: 5 RYRLAAKLLLSCIRDGMRTLKADQRAVLKGLSLTGSKWDAKKFKQKMRIAKLLYY 169 RYR A+KLLLSC+R GM+ LK+ QRAVL GL +G +A+K + K+RIA++L Y Sbjct: 451 RYRSASKLLLSCLRSGMKILKSAQRAVLSGLRYSGFPGEARKVQSKIRIARILNY 505 >ref|XP_004243786.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like [Solanum lycopersicum] Length = 460 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/54 (55%), Positives = 42/54 (77%) Frame = +2 Query: 2 KRYRLAAKLLLSCIRDGMRTLKADQRAVLKGLSLTGSKWDAKKFKQKMRIAKLL 163 +R+R A+KLLLSCIR GMR LK+D+R V+ GL +G +AKK + K+R+AK+L Sbjct: 405 RRFRAASKLLLSCIRGGMRILKSDKRGVIDGLRGSGYSQEAKKIQSKIRLAKIL 458 >ref|XP_004232338.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like isoform 1 [Solanum lycopersicum] gi|460373057|ref|XP_004232339.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like isoform 2 [Solanum lycopersicum] Length = 460 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/56 (53%), Positives = 43/56 (76%) Frame = +2 Query: 2 KRYRLAAKLLLSCIRDGMRTLKADQRAVLKGLSLTGSKWDAKKFKQKMRIAKLLYY 169 +R+R A+KLLLSCIR GMR LK+D+R V+ GL G +A+K + K+++AKLL+Y Sbjct: 405 RRFRAASKLLLSCIRGGMRILKSDKRIVIDGLRSCGLTHEARKVQSKIQMAKLLHY 460 >ref|XP_006357835.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like isoform X1 [Solanum tuberosum] gi|565383043|ref|XP_006357836.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like isoform X2 [Solanum tuberosum] gi|565383045|ref|XP_006357837.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like isoform X3 [Solanum tuberosum] Length = 460 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/56 (53%), Positives = 43/56 (76%) Frame = +2 Query: 2 KRYRLAAKLLLSCIRDGMRTLKADQRAVLKGLSLTGSKWDAKKFKQKMRIAKLLYY 169 +R+R A+KLLLSCIR GMR LK+D+R V+ GL G +A+K + K+++AKLL+Y Sbjct: 405 RRFRAASKLLLSCIRGGMRILKSDKRIVVDGLRSCGLTHEARKVQSKIQMAKLLHY 460 >emb|CBI26532.3| unnamed protein product [Vitis vinifera] Length = 441 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/56 (46%), Positives = 45/56 (80%) Frame = +2 Query: 2 KRYRLAAKLLLSCIRDGMRTLKADQRAVLKGLSLTGSKWDAKKFKQKMRIAKLLYY 169 +RYR A++LLL+C+R GM+ L+A+QR+V+ GL +G +A++ K K+R+A++L+Y Sbjct: 386 RRYRHASRLLLACLRGGMKILRANQRSVIDGLCYSGYTSEARRLKSKIRLARILHY 441 >ref|XP_002274300.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like [Vitis vinifera] Length = 457 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/56 (46%), Positives = 45/56 (80%) Frame = +2 Query: 2 KRYRLAAKLLLSCIRDGMRTLKADQRAVLKGLSLTGSKWDAKKFKQKMRIAKLLYY 169 +RYR A++LLL+C+R GM+ L+A+QR+V+ GL +G +A++ K K+R+A++L+Y Sbjct: 402 RRYRHASRLLLACLRGGMKILRANQRSVIDGLCYSGYTSEARRLKSKIRLARILHY 457 >ref|XP_006348886.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like [Solanum tuberosum] Length = 460 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/55 (50%), Positives = 42/55 (76%) Frame = +2 Query: 2 KRYRLAAKLLLSCIRDGMRTLKADQRAVLKGLSLTGSKWDAKKFKQKMRIAKLLY 166 +R+R A+KLLLSCIR GMR LK+D+R V+ GL +G +A+K + K+R+A +L+ Sbjct: 405 RRFRAASKLLLSCIRGGMRILKSDKRGVIDGLRGSGYSQEARKVQSKIRLATILH 459 >gb|EXB92364.1| hypothetical protein L484_021348 [Morus notabilis] Length = 453 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/55 (50%), Positives = 43/55 (78%) Frame = +2 Query: 2 KRYRLAAKLLLSCIRDGMRTLKADQRAVLKGLSLTGSKWDAKKFKQKMRIAKLLY 166 KRY+ AAKLLLSC++DGM+ L++ +RAVL GL +G +A K K ++R+A++L+ Sbjct: 399 KRYKCAAKLLLSCLKDGMKVLRSARRAVLDGLRGSGLIHEANKLKLELRMAQILH 453 >ref|XP_004151692.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like [Cucumis sativus] gi|449468117|ref|XP_004151768.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like [Cucumis sativus] gi|449532400|ref|XP_004173169.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915-like [Cucumis sativus] Length = 456 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/52 (51%), Positives = 40/52 (76%) Frame = +2 Query: 2 KRYRLAAKLLLSCIRDGMRTLKADQRAVLKGLSLTGSKWDAKKFKQKMRIAK 157 +R+R A+KLL+SC RDGM+ LKA +RAV+ GL +G +A+K K K+R+A+ Sbjct: 402 RRFRCASKLLISCSRDGMKVLKATRRAVIDGLCSSGFTSEARKLKFKLRLAR 453 >ref|XP_002532784.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527472|gb|EEF29603.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 487 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/55 (43%), Positives = 41/55 (74%) Frame = +2 Query: 5 RYRLAAKLLLSCIRDGMRTLKADQRAVLKGLSLTGSKWDAKKFKQKMRIAKLLYY 169 R+ A+KLLLSC+R GM+ L + QR V+ GL +G + +A+K K K+++A++L++ Sbjct: 433 RFHRASKLLLSCLRSGMKILPSAQRVVISGLRYSGFQKEARKLKSKIKLARMLHH 487