BLASTX nr result
ID: Rehmannia23_contig00015151
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00015151 (504 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004500419.1| PREDICTED: WAT1-related protein At3g02690, c... 57 3e-06 ref|XP_002318202.2| hypothetical protein POPTR_0012s12810g [Popu... 55 1e-05 >ref|XP_004500419.1| PREDICTED: WAT1-related protein At3g02690, chloroplastic-like [Cicer arietinum] Length = 411 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/30 (80%), Positives = 30/30 (100%) Frame = +3 Query: 3 FIYLGETFTPVQLVGAVITVAAIYMVNYKN 92 F+YLGETF+PVQLVGA++TVAAIYMVN++N Sbjct: 378 FLYLGETFSPVQLVGAIVTVAAIYMVNFRN 407 >ref|XP_002318202.2| hypothetical protein POPTR_0012s12810g [Populus trichocarpa] gi|550327001|gb|EEE96422.2| hypothetical protein POPTR_0012s12810g [Populus trichocarpa] Length = 455 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = +3 Query: 3 FIYLGETFTPVQLVGAVITVAAIYMVNYKNGTD 101 F+YLGETF+P+QL GA++TV AIYMVNY+N + Sbjct: 423 FLYLGETFSPLQLAGAIVTVVAIYMVNYRNSNE 455