BLASTX nr result
ID: Rehmannia23_contig00014357
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00014357 (412 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ16947.1| hypothetical protein PRUPE_ppa009265mg [Prunus pe... 55 1e-05 >gb|EMJ16947.1| hypothetical protein PRUPE_ppa009265mg [Prunus persica] Length = 299 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/55 (49%), Positives = 34/55 (61%) Frame = +3 Query: 246 KHSSPKPRLVRGXXXXXXXXXXXXXXXDKPTVPDNEFTLAKVSFGVIGLGVGVTL 410 +HS PKP+L R DK VPD++F+LAKVSFGVIGLG G++L Sbjct: 70 QHSKPKPKLTRARAADSTQPTTVSSTADKTVVPDDQFSLAKVSFGVIGLGGGLSL 124