BLASTX nr result
ID: Rehmannia23_contig00014092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00014092 (387 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS70232.1| hypothetical protein M569_04529, partial [Genlise... 65 9e-09 >gb|EPS70232.1| hypothetical protein M569_04529, partial [Genlisea aurea] Length = 289 Score = 65.1 bits (157), Expect = 9e-09 Identities = 55/163 (33%), Positives = 78/163 (47%), Gaps = 38/163 (23%) Frame = +1 Query: 10 RLRMKRHRPKVYDEMKAVK-----------------PLTPKPQTPKRAKHTTKDNXXXXX 138 R++MKRHRPKV+DE K + P TP +TPKRA Sbjct: 18 RMKMKRHRPKVFDETKPRRKPTTCKVKIQKNNAKHSPTTPSSRTPKRA----------LS 67 Query: 139 XXXDSPKTIVEPSKEVDKELGDYNTNSCRKKLDFDS-------------------ESKPN 261 DS K+ ++ KEV++ G + +SCR+ L F S +S+P+ Sbjct: 68 PKTDSFKSCIDDEKEVNQ--GFFVEHSCRRALVFSSSDDISLDQKSSDILLDSVAQSQPH 125 Query: 262 LEPKNLLVY-RRRIFKCLKNSRKLGPNW-TLFKKARMIRQRAT 384 E VY RRR CL N+RKLG N+ + K++RM R++AT Sbjct: 126 DESSCFRVYQRRRKDDCLWNNRKLGLNFPKMCKRSRMKRRKAT 168