BLASTX nr result
ID: Rehmannia23_contig00012663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00012663 (432 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006359496.1| PREDICTED: pyrophosphate-energized vacuolar ... 146 2e-33 emb|CAC39165.1| vacuolar-type H+-pyrophosphatase [Solanum lycope... 146 2e-33 ref|NP_001265905.1| vacuolar-type H+-pyrophosphatase [Solanum ly... 146 2e-33 gb|AHA38114.1| vacuolar H+-pyrophosphatase [Sesuvium portulacast... 146 3e-33 gb|AFQ00710.1| pyrophosphate-energized vacuolar membrane proteon... 145 4e-33 gb|ESW27074.1| hypothetical protein PHAVU_003G171500g [Phaseolus... 145 5e-33 gb|EXB66631.1| Pyrophosphate-energized vacuolar membrane proton ... 145 7e-33 emb|CAA58700.1| inorganic pyrophosphatase [Nicotiana tabacum] 145 7e-33 ref|XP_004303283.1| PREDICTED: pyrophosphate-energized vacuolar ... 145 7e-33 gb|EMJ18358.1| hypothetical protein PRUPE_ppa001776mg [Prunus pe... 145 7e-33 emb|CAA58701.1| inorganic pyrophosphatase [Nicotiana tabacum] 145 7e-33 dbj|BAC41250.1| vacuolar proton-inorganic pyrophosphatase [Pyrus... 145 7e-33 ref|XP_003632833.1| PREDICTED: pyrophosphate-energized vacuolar ... 145 7e-33 ref|XP_003632767.1| PREDICTED: pyrophosphate-energized vacuolar ... 145 7e-33 ref|XP_002530755.1| Pyrophosphate-energized vacuolar membrane pr... 145 7e-33 ref|XP_002273207.1| PREDICTED: pyrophosphate-energized vacuolar ... 145 7e-33 gb|ABF85694.1| inorganic pyrophosphatase [Nicotiana rustica] 145 7e-33 gb|AAL11506.1|AF367446_1 vacuolar H+-pyrophosphatase [Prunus per... 145 7e-33 gb|ACT98610.2| vacuolar proton-inorganic pyrophosphatase [Diplac... 144 9e-33 gb|ADQ00196.1| vacuolar H+-PPase protein [Suaeda corniculata] 144 9e-33 >ref|XP_006359496.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Solanum tuberosum] Length = 765 Score = 146 bits (369), Expect = 2e-33 Identities = 72/73 (98%), Positives = 73/73 (100%) Frame = +1 Query: 1 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 180 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP Sbjct: 693 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 752 Query: 181 FFATHGGLLFKIF 219 FFATHGGLLFK+F Sbjct: 753 FFATHGGLLFKLF 765 >emb|CAC39165.1| vacuolar-type H+-pyrophosphatase [Solanum lycopersicum] Length = 356 Score = 146 bits (369), Expect = 2e-33 Identities = 72/73 (98%), Positives = 73/73 (100%) Frame = +1 Query: 1 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 180 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP Sbjct: 284 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 343 Query: 181 FFATHGGLLFKIF 219 FFATHGGLLFK+F Sbjct: 344 FFATHGGLLFKLF 356 >ref|NP_001265905.1| vacuolar-type H+-pyrophosphatase [Solanum lycopersicum] gi|410508837|dbj|BAM65603.1| vacuolar H+-pyrophosphatase [Solanum lycopersicum] Length = 765 Score = 146 bits (369), Expect = 2e-33 Identities = 72/73 (98%), Positives = 73/73 (100%) Frame = +1 Query: 1 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 180 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP Sbjct: 693 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 752 Query: 181 FFATHGGLLFKIF 219 FFATHGGLLFK+F Sbjct: 753 FFATHGGLLFKLF 765 >gb|AHA38114.1| vacuolar H+-pyrophosphatase [Sesuvium portulacastrum] Length = 765 Score = 146 bits (368), Expect = 3e-33 Identities = 72/73 (98%), Positives = 73/73 (100%) Frame = +1 Query: 1 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 180 KKYIEAGAS+HARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP Sbjct: 693 KKYIEAGASDHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 752 Query: 181 FFATHGGLLFKIF 219 FFATHGGLLFKIF Sbjct: 753 FFATHGGLLFKIF 765 >gb|AFQ00710.1| pyrophosphate-energized vacuolar membrane proteon pump 1 [Ipomoea batatas] Length = 767 Score = 145 bits (367), Expect = 4e-33 Identities = 72/73 (98%), Positives = 72/73 (98%) Frame = +1 Query: 1 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 180 KKYIEAGASEHARTLGPKGSD HKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP Sbjct: 695 KKYIEAGASEHARTLGPKGSDCHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 754 Query: 181 FFATHGGLLFKIF 219 FFATHGGLLFKIF Sbjct: 755 FFATHGGLLFKIF 767 >gb|ESW27074.1| hypothetical protein PHAVU_003G171500g [Phaseolus vulgaris] Length = 766 Score = 145 bits (366), Expect = 5e-33 Identities = 71/73 (97%), Positives = 72/73 (98%) Frame = +1 Query: 1 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 180 KKYIEAGASEHARTLGPKGSD HKAAVIGDT+GDPLKDTSGPSLNILIKLMAVESLVFAP Sbjct: 694 KKYIEAGASEHARTLGPKGSDCHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAP 753 Query: 181 FFATHGGLLFKIF 219 FFATHGGLLFKIF Sbjct: 754 FFATHGGLLFKIF 766 >gb|EXB66631.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus notabilis] Length = 764 Score = 145 bits (365), Expect = 7e-33 Identities = 71/73 (97%), Positives = 72/73 (98%) Frame = +1 Query: 1 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 180 KKYIEAGASEHARTLGPKGSD HKAAVIGDT+GDPLKDTSGPSLNILIKLMAVESLVFAP Sbjct: 692 KKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAP 751 Query: 181 FFATHGGLLFKIF 219 FFATHGGLLFKIF Sbjct: 752 FFATHGGLLFKIF 764 >emb|CAA58700.1| inorganic pyrophosphatase [Nicotiana tabacum] Length = 766 Score = 145 bits (365), Expect = 7e-33 Identities = 71/73 (97%), Positives = 72/73 (98%) Frame = +1 Query: 1 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 180 KKYIEAG SEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP Sbjct: 694 KKYIEAGVSEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 753 Query: 181 FFATHGGLLFKIF 219 FFATHGGLLFK+F Sbjct: 754 FFATHGGLLFKLF 766 >ref|XP_004303283.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1-like [Fragaria vesca subsp. vesca] Length = 767 Score = 145 bits (365), Expect = 7e-33 Identities = 71/73 (97%), Positives = 72/73 (98%) Frame = +1 Query: 1 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 180 KKYIEAGASEHARTLGPKGSD HKAAVIGDT+GDPLKDTSGPSLNILIKLMAVESLVFAP Sbjct: 695 KKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAP 754 Query: 181 FFATHGGLLFKIF 219 FFATHGGLLFKIF Sbjct: 755 FFATHGGLLFKIF 767 >gb|EMJ18358.1| hypothetical protein PRUPE_ppa001776mg [Prunus persica] Length = 767 Score = 145 bits (365), Expect = 7e-33 Identities = 71/73 (97%), Positives = 72/73 (98%) Frame = +1 Query: 1 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 180 KKYIEAGASEHARTLGPKGSD HKAAVIGDT+GDPLKDTSGPSLNILIKLMAVESLVFAP Sbjct: 695 KKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAP 754 Query: 181 FFATHGGLLFKIF 219 FFATHGGLLFKIF Sbjct: 755 FFATHGGLLFKIF 767 >emb|CAA58701.1| inorganic pyrophosphatase [Nicotiana tabacum] Length = 765 Score = 145 bits (365), Expect = 7e-33 Identities = 71/73 (97%), Positives = 72/73 (98%) Frame = +1 Query: 1 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 180 KKYIEAGASEHARTLGPKGSD HKAAVIGDT+GDPLKDTSGPSLNILIKLMAVESLVFAP Sbjct: 693 KKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAP 752 Query: 181 FFATHGGLLFKIF 219 FFATHGGLLFKIF Sbjct: 753 FFATHGGLLFKIF 765 >dbj|BAC41250.1| vacuolar proton-inorganic pyrophosphatase [Pyrus communis] Length = 767 Score = 145 bits (365), Expect = 7e-33 Identities = 71/73 (97%), Positives = 72/73 (98%) Frame = +1 Query: 1 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 180 KKYIEAGASEHARTLGPKGSD HKAAVIGDT+GDPLKDTSGPSLNILIKLMAVESLVFAP Sbjct: 695 KKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAP 754 Query: 181 FFATHGGLLFKIF 219 FFATHGGLLFKIF Sbjct: 755 FFATHGGLLFKIF 767 >ref|XP_003632833.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1-like [Vitis vinifera] Length = 418 Score = 145 bits (365), Expect = 7e-33 Identities = 71/73 (97%), Positives = 72/73 (98%) Frame = +1 Query: 1 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 180 KKYIEAGASEHARTLGPKGSD HKAAVIGDT+GDPLKDTSGPSLNILIKLMAVESLVFAP Sbjct: 346 KKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAP 405 Query: 181 FFATHGGLLFKIF 219 FFATHGGLLFKIF Sbjct: 406 FFATHGGLLFKIF 418 >ref|XP_003632767.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump 1-like [Vitis vinifera] gi|297743533|emb|CBI36400.3| unnamed protein product [Vitis vinifera] Length = 395 Score = 145 bits (365), Expect = 7e-33 Identities = 71/73 (97%), Positives = 72/73 (98%) Frame = +1 Query: 1 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 180 KKYIEAGASEHARTLGPKGSD HKAAVIGDT+GDPLKDTSGPSLNILIKLMAVESLVFAP Sbjct: 323 KKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAP 382 Query: 181 FFATHGGLLFKIF 219 FFATHGGLLFKIF Sbjct: 383 FFATHGGLLFKIF 395 >ref|XP_002530755.1| Pyrophosphate-energized vacuolar membrane proton pump, putative [Ricinus communis] gi|223529671|gb|EEF31615.1| Pyrophosphate-energized vacuolar membrane proton pump, putative [Ricinus communis] Length = 767 Score = 145 bits (365), Expect = 7e-33 Identities = 71/73 (97%), Positives = 72/73 (98%) Frame = +1 Query: 1 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 180 KKYIEAGASEHARTLGPKGSD HKAAVIGDT+GDPLKDTSGPSLNILIKLMAVESLVFAP Sbjct: 695 KKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAP 754 Query: 181 FFATHGGLLFKIF 219 FFATHGGLLFKIF Sbjct: 755 FFATHGGLLFKIF 767 >ref|XP_002273207.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump [Vitis vinifera] gi|297743526|emb|CBI36393.3| unnamed protein product [Vitis vinifera] Length = 767 Score = 145 bits (365), Expect = 7e-33 Identities = 71/73 (97%), Positives = 72/73 (98%) Frame = +1 Query: 1 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 180 KKYIEAGASEHARTLGPKGSD HKAAVIGDT+GDPLKDTSGPSLNILIKLMAVESLVFAP Sbjct: 695 KKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAP 754 Query: 181 FFATHGGLLFKIF 219 FFATHGGLLFKIF Sbjct: 755 FFATHGGLLFKIF 767 >gb|ABF85694.1| inorganic pyrophosphatase [Nicotiana rustica] Length = 765 Score = 145 bits (365), Expect = 7e-33 Identities = 71/73 (97%), Positives = 72/73 (98%) Frame = +1 Query: 1 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 180 KKYIEAGASEHARTLGPKGSD HKAAVIGDT+GDPLKDTSGPSLNILIKLMAVESLVFAP Sbjct: 693 KKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAP 752 Query: 181 FFATHGGLLFKIF 219 FFATHGGLLFKIF Sbjct: 753 FFATHGGLLFKIF 765 >gb|AAL11506.1|AF367446_1 vacuolar H+-pyrophosphatase [Prunus persica] Length = 767 Score = 145 bits (365), Expect = 7e-33 Identities = 71/73 (97%), Positives = 72/73 (98%) Frame = +1 Query: 1 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 180 KKYIEAGASEHARTLGPKGSD HKAAVIGDT+GDPLKDTSGPSLNILIKLMAVESLVFAP Sbjct: 695 KKYIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAP 754 Query: 181 FFATHGGLLFKIF 219 FFATHGGLLFKIF Sbjct: 755 FFATHGGLLFKIF 767 >gb|ACT98610.2| vacuolar proton-inorganic pyrophosphatase [Diplachne fusca] Length = 763 Score = 144 bits (364), Expect = 9e-33 Identities = 70/73 (95%), Positives = 72/73 (98%) Frame = +1 Query: 1 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 180 KKYIEAGASEHARTLGPKGSD HKAAVIGDT+GDPLKDTSGPSLNILIKLMAVESLVFAP Sbjct: 691 KKYIEAGASEHARTLGPKGSDCHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAP 750 Query: 181 FFATHGGLLFKIF 219 FFATHGGLLFK+F Sbjct: 751 FFATHGGLLFKLF 763 >gb|ADQ00196.1| vacuolar H+-PPase protein [Suaeda corniculata] Length = 764 Score = 144 bits (364), Expect = 9e-33 Identities = 71/73 (97%), Positives = 72/73 (98%) Frame = +1 Query: 1 KKYIEAGASEHARTLGPKGSDAHKAAVIGDTVGDPLKDTSGPSLNILIKLMAVESLVFAP 180 KKYIEAGASEHAR LGPKGSDAHKAAVIGDT+GDPLKDTSGPSLNILIKLMAVESLVFAP Sbjct: 692 KKYIEAGASEHARQLGPKGSDAHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAP 751 Query: 181 FFATHGGLLFKIF 219 FFATHGGLLFKIF Sbjct: 752 FFATHGGLLFKIF 764