BLASTX nr result
ID: Rehmannia23_contig00011883
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00011883 (496 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY33369.1| F-box and associated interaction domains-containi... 59 9e-07 >gb|EOY33369.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786114|gb|EOY33370.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 387 Score = 58.5 bits (140), Expect = 9e-07 Identities = 42/131 (32%), Positives = 70/131 (53%) Frame = -1 Query: 478 AEAEVELVDWNGSLGALVCTKDNERVQSLDAWVFDDGEQIWRKNHTFGPIEVNVDRFLQC 299 A+ ++L+D+NGSLGA+V ++ +S+D WV + W + + + V+R L Sbjct: 262 AQYYLQLLDFNGSLGAIVYPREGTE-KSIDLWVMNGS---WTRQFSIESVS-GVERPLGF 316 Query: 298 SKNGKILGELPNGKLFVFDPKTRCVKVLFYGAQQLQSFEIYGYTESLSCIKGMRQVQAMR 119 KNG++ E N +L +FDP TR +K L A Q + ++ Y ESL I G + + Sbjct: 317 WKNGELFLESSNHELVLFDPATRELKNLGIHAYQ-NTMQLIAYVESLVPINGRSEQEEHI 375 Query: 118 RKRKMIDDATR 86 +R+ D + R Sbjct: 376 IRRRAGDASNR 386